DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD3 and AT1G20580

DIOPT Version :9

Sequence 1:NP_725106.1 Gene:SmD3 / 36306 FlyBaseID:FBgn0023167 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_564119.1 Gene:AT1G20580 / 838647 AraportID:AT1G20580 Length:131 Species:Arabidopsis thaliana


Alignment Length:146 Identity:69/146 - (47%)
Similarity:91/146 - (62%) Gaps:25/146 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRDGRTANLENVYIRGS 66
            |:|:|:|:||||.|||:|.|..:||:|||.:||.|||.|||:..||.|.:||:.:.||:|:||||
plant     4 SLGIPVKLLHEASGHIVTVELKSGELYRGSMIECEDNWNCQLEDITYTAKDGKVSQLEHVFIRGS 68

  Fly    67 KIRFLILPDMLKNAPMFKKQTGKGLGGTAGRGKAAILRAQARGRGRGGPPGGGRGTGGPPGAPGG 131
            |:||:::||:||:|||||                   |..||.:|:....|.|||.|...|.|..
plant    69 KVRFMVIPDILKHAPMFK-------------------RLDARIKGKSSSLGVGRGRGAMRGKPAA 114

  Fly   132 SGGRGAWQGGPTGGRG 147
            ..|||      |||||
plant   115 GPGRG------TGGRG 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD3NP_725106.1 Sm_D3 6..75 CDD:212468 39/68 (57%)
AT1G20580NP_564119.1 Sm_D3 8..77 CDD:212468 39/68 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 87 1.000 Domainoid score I2749
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3078
Inparanoid 1 1.050 143 1.000 Inparanoid score I1770
OMA 1 1.010 - - QHG53728
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004370
OrthoInspector 1 1.000 - - otm3193
orthoMCL 1 0.900 - - OOG6_102085
Panther 1 1.100 - - LDO PTHR23338
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3092
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.