powered by:
Protein Alignment SmD3 and SAD1
DIOPT Version :9
Sequence 1: | NP_725106.1 |
Gene: | SmD3 / 36306 |
FlyBaseID: | FBgn0023167 |
Length: | 151 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_199698.1 |
Gene: | SAD1 / 834945 |
AraportID: | AT5G48870 |
Length: | 88 |
Species: | Arabidopsis thaliana |
Alignment Length: | 71 |
Identity: | 15/71 - (21%) |
Similarity: | 32/71 - (45%) |
Gaps: | 10/71 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 IGVPIKVLHEAEGHIITCETITG-EVYRGKLIEAEDNMNCQMTQITVTYRDGRTANLENVYIRGS 66
||..|.|:.:.:..:: ..:.| :||...::| .:|:..:|....|...|:.:.:.|:
plant 18 IGSKIWVIMKGDKELV--GILKGFDVYVNMVLE-------DVTEYEITAEGRRVTKLDQILLNGN 73
Fly 67 KIRFLI 72
.|..|:
plant 74 NIAILV 79
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmD3 | NP_725106.1 |
Sm_D3 |
6..75 |
CDD:212468 |
13/68 (19%) |
SAD1 | NP_199698.1 |
LSm5 |
7..82 |
CDD:212479 |
15/71 (21%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.