DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD3 and emb1644

DIOPT Version :9

Sequence 1:NP_725106.1 Gene:SmD3 / 36306 FlyBaseID:FBgn0023167 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_198124.1 Gene:emb1644 / 832834 AraportID:AT5G27720 Length:129 Species:Arabidopsis thaliana


Alignment Length:152 Identity:52/152 - (34%)
Similarity:74/152 - (48%) Gaps:31/152 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRDG-RTANLENVYIRGSKI 68
            :|:.:|..|:||.:..|...||.|.|.|:..:..||..:.::..|.:|| |...:...||||:.|
plant     2 LPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTI 66

  Fly    69 RFLILPD-MLKNAPMFKKQTGK---GLGGTAGRGKAAILRAQARGRGRGGPPGG--GRGTGGPPG 127
            ::|.:|| ::......|.:|.:   |:|               ||||||...||  |||.|...|
plant    67 KYLRVPDEVIDKVQEEKTRTDRKPPGVG---------------RGRGRGVDDGGARGRGRGTSMG 116

  Fly   128 APGGSGGRGAWQGGPTGGRGRG 149
            ..||:  |||       |||||
plant   117 KMGGN--RGA-------GRGRG 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD3NP_725106.1 Sm_D3 6..75 CDD:212468 23/69 (33%)
emb1644NP_198124.1 LSm4 2..77 CDD:212470 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.