DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD3 and SNRPB

DIOPT Version :9

Sequence 1:NP_725106.1 Gene:SmD3 / 36306 FlyBaseID:FBgn0023167 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_937859.1 Gene:SNRPB / 6628 HGNCID:11153 Length:240 Species:Homo sapiens


Alignment Length:212 Identity:47/212 - (22%)
Similarity:71/212 - (33%) Gaps:67/212 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMN---CQMTQI-TVTYRDGRTANLEN- 60
            |::|...|:|...: :.:.|....|.::.|.....:.:||   |...:. .:..::.:.|..|. 
Human     1 MTVGKSSKMLQHID-YRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEK 64

  Fly    61 -----VYIRGSKIRFLILPDM------LKNAPMFKKQTGKGLGGTAGRGKAA------------- 101
                 |.:||..:..:.:...      :...|:.....|.|:|..||||..|             
Human    65 RVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAG 129

  Fly   102 -----------ILRAQARGR---------------------GRGGPPGG-GRGTGGPPGAPGGSG 133
                       ::..|.||.                     ||||||.. ||| ..|||..|...
Human   130 PVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRG-APPPGMMGPPP 193

  Fly   134 GRGAWQGGPTG---GRG 147
            |.....|.|.|   |||
Human   194 GMRPPMGPPMGIPPGRG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD3NP_725106.1 Sm_D3 6..75 CDD:212468 13/78 (17%)
SNRPBNP_937859.1 Sm_B 5..83 CDD:212464 13/78 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..240 20/49 (41%)
Repeat-rich region 175..236 16/37 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.