DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD3 and snrpd3

DIOPT Version :9

Sequence 1:NP_725106.1 Gene:SmD3 / 36306 FlyBaseID:FBgn0023167 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_001017093.1 Gene:snrpd3 / 549847 XenbaseID:XB-GENE-1014502 Length:126 Species:Xenopus tropicalis


Alignment Length:123 Identity:99/123 - (80%)
Similarity:102/123 - (82%) Gaps:6/123 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRDGRTANLENVYIRG 65
            |||||||||||||||||:||||.||||||||||||||||||||:.|||||||||.|.||.|||||
 Frog     1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRG 65

  Fly    66 SKIRFLILPDMLKNAPMFKKQTGKGLGGTAGRGKAAILRAQ--ARGRGRGGPPGGGRG 121
            |||||||||||||||||.|....|..|..|||||||||:||  ||||||    |.|||
 Frog    66 SKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGR----GMGRG 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD3NP_725106.1 Sm_D3 6..75 CDD:212468 61/68 (90%)
snrpd3NP_001017093.1 Sm_D3 6..75 CDD:212468 61/68 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 119 1.000 Domainoid score I5745
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3078
Inparanoid 1 1.050 190 1.000 Inparanoid score I3768
OMA 1 1.010 - - QHG53728
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004370
OrthoInspector 1 1.000 - - oto102552
Panther 1 1.100 - - LDO PTHR23338
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.