powered by:
Protein Alignment SmD3 and CG10418
DIOPT Version :9
Sequence 1: | NP_725106.1 |
Gene: | SmD3 / 36306 |
FlyBaseID: | FBgn0023167 |
Length: | 151 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_648570.1 |
Gene: | CG10418 / 39408 |
FlyBaseID: | FBgn0036277 |
Length: | 95 |
Species: | Drosophila melanogaster |
Alignment Length: | 69 |
Identity: | 19/69 - (27%) |
Similarity: | 35/69 - (50%) |
Gaps: | 11/69 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 KVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRD--GRTANLENVYIRGSKIRF 70
:|:.|.:..:..| |.|...:..:|.::|.|:||..| ....:::|.:||||.:|:
Fly 14 EVVVELKNDLSIC---------GTLHSVDQYLNIKLTDISVTDPDKYPHMLSVKNCFIRGSVVRY 69
Fly 71 LILP 74
:.||
Fly 70 VQLP 73
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmD3 | NP_725106.1 |
Sm_D3 |
6..75 |
CDD:212468 |
19/69 (28%) |
CG10418 | NP_648570.1 |
LSm2 |
2..90 |
CDD:212472 |
19/69 (28%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.