DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD3 and snrpd3l

DIOPT Version :9

Sequence 1:NP_725106.1 Gene:SmD3 / 36306 FlyBaseID:FBgn0023167 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_956054.1 Gene:snrpd3l / 327011 ZFINID:ZDB-GENE-030131-5219 Length:128 Species:Danio rerio


Alignment Length:123 Identity:101/123 - (82%)
Similarity:105/123 - (85%) Gaps:4/123 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRDGRTANLENVYIRG 65
            |||||||||||||||||:||||.||||||||||||||||||||:.|||||||||.:.||.|||||
Zfish     1 MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVSQLEQVYIRG 65

  Fly    66 SKIRFLILPDMLKNAPMFKKQTGKGLGGTAGRGKAAILRAQ--ARGRGRGGPPGGGRG 121
            |||||||||||||||||.|....|..|..|||||||||:||  |||||||||  ||||
Zfish    66 SKIRFLILPDMLKNAPMLKSMKNKNQGAGAGRGKAAILKAQVAARGRGRGGP--GGRG 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD3NP_725106.1 Sm_D3 6..75 CDD:212468 60/68 (88%)
snrpd3lNP_956054.1 Sm_D3 6..75 CDD:212468 60/68 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575019
Domainoid 1 1.000 118 1.000 Domainoid score I5842
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 196 1.000 Inparanoid score I3802
OMA 1 1.010 - - QHG53728
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004370
OrthoInspector 1 1.000 - - oto41413
orthoMCL 1 0.900 - - OOG6_102085
Panther 1 1.100 - - LDO PTHR23338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1359
SonicParanoid 1 1.000 - - X3092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.830

Return to query results.
Submit another query.