DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD3 and snrpd1

DIOPT Version :9

Sequence 1:NP_725106.1 Gene:SmD3 / 36306 FlyBaseID:FBgn0023167 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_775359.1 Gene:snrpd1 / 192331 ZFINID:ZDB-GENE-020419-14 Length:119 Species:Danio rerio


Alignment Length:123 Identity:41/123 - (33%)
Similarity:57/123 - (46%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRDGRTANLENVYIRGSKIRFL 71
            :|:.||.    :|.|...|....|.:...:.:||..:..:.:|.::.....||::.|||:.||:.
Zfish     8 MKLSHET----VTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPTQLESLSIRGNNIRYF 68

  Fly    72 ILPDMLKNAPMF----KKQTGKGLGGTAGRGKAAILRAQARGRGRGGPPGGGRGTGGP 125
            ||||.|....:.    .|...|.....||||         ||||||...|.|||.|||
Zfish    69 ILPDSLPLDTLLVDIEPKVKSKKREAVAGRG---------RGRGRGRGRGRGRGRGGP 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD3NP_725106.1 Sm_D3 6..75 CDD:212468 19/67 (28%)
snrpd1NP_775359.1 Sm_D1 2..93 CDD:212471 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.