DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmD3 and snr-1

DIOPT Version :9

Sequence 1:NP_725106.1 Gene:SmD3 / 36306 FlyBaseID:FBgn0023167 Length:151 Species:Drosophila melanogaster
Sequence 2:NP_503027.1 Gene:snr-1 / 178483 WormBaseID:WBGene00004914 Length:136 Species:Caenorhabditis elegans


Alignment Length:137 Identity:84/137 - (61%)
Similarity:98/137 - (71%) Gaps:16/137 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SIGVPIKVLHEAEGHIITCETITGEVYRGKLIEAEDNMNCQMTQITVTYRDGRTANLENVYIRGS 66
            |:|||||:|||||||::|.||:|||||||||.|||||||||:.:..||:||||:..|:||:|||:
 Worm     3 SVGVPIKILHEAEGHMVTLETVTGEVYRGKLSEAEDNMNCQLAETVVTFRDGRSHQLDNVFIRGN 67

  Fly    67 KIRFLILPDMLKNAPMFKK-------QTGKGLGG--TAGRGKAAILRAQARGRGRGGPPGGGRGT 122
            ||||:|||||||||||||.       ..|.||||  ..|||:....|   |..|||||    ||.
 Worm    68 KIRFMILPDMLKNAPMFKNIGRAQKGAIGMGLGGLDQRGRGRGTAFR---RPMGRGGP----RGM 125

  Fly   123 GGPPGAP 129
            ..|.|||
 Worm   126 SRPGGAP 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmD3NP_725106.1 Sm_D3 6..75 CDD:212468 49/68 (72%)
snr-1NP_503027.1 Sm_D3 7..76 CDD:212468 49/68 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156692
Domainoid 1 1.000 104 1.000 Domainoid score I4237
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3078
Inparanoid 1 1.050 159 1.000 Inparanoid score I2883
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53728
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004370
OrthoInspector 1 1.000 - - oto18425
orthoMCL 1 0.900 - - OOG6_102085
Panther 1 1.100 - - LDO PTHR23338
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1359
SonicParanoid 1 1.000 - - X3092
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.