powered by:
Protein Alignment SmD3 and snr-6
DIOPT Version :9
Sequence 1: | NP_725106.1 |
Gene: | SmD3 / 36306 |
FlyBaseID: | FBgn0023167 |
Length: | 151 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_499620.1 |
Gene: | snr-6 / 176668 |
WormBaseID: | WBGene00004919 |
Length: | 90 |
Species: | Caenorhabditis elegans |
Alignment Length: | 64 |
Identity: | 16/64 - (25%) |
Similarity: | 26/64 - (40%) |
Gaps: | 16/64 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 VLHEAEGHIITCETITGEVYRGKLIEAED-NMNCQMTQITVTYRDGRTANLENVYIRGSKIRFL 71
|.|..||:||..:.....|:. |||: ||..: ||. .:..:.::|..|..:
Worm 35 VTHRLEGYIIGFDEFMNVVFD----EAEEVNMKTK----------GRN-KIGRILLKGDNITLI 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmD3 | NP_725106.1 |
Sm_D3 |
6..75 |
CDD:212468 |
16/64 (25%) |
snr-6 | NP_499620.1 |
Sm_E |
8..85 |
CDD:212465 |
16/64 (25%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.