DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8407 and AT5G20110

DIOPT Version :9

Sequence 1:NP_001163124.1 Gene:CG8407 / 36303 FlyBaseID:FBgn0033687 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_197511.1 Gene:AT5G20110 / 832133 AraportID:AT5G20110 Length:209 Species:Arabidopsis thaliana


Alignment Length:122 Identity:33/122 - (27%)
Similarity:53/122 - (43%) Gaps:35/122 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 AGKEGEKKIVHVYPLVKHTDMNEEMRIEA-------------------------IELSITACEKY 45
            |.:||.|.:.||       :.:...||||                         ..:::.:.||:
plant    89 AAEEGRKSVSHV-------ERDTAARIEAAAEMLTVRILAADMPGFMQAHAFRCARMTLDSLEKF 146

  Fly    46 SSNYEHAAKIIKENMDKKFGIYWHVVVGEGFGFEVSYETENILYLFFAGNLAIVLWK 102
            ||  :|.|..:|:..||.:|..||.:||..||..|::.|...:| |....|.::|:|
plant   147 SS--KHMAFNLKKEFDKGYGPAWHCIVGSSFGSFVTHSTGCFIY-FSMDKLYVLLFK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8407NP_001163124.1 Dynein_light 18..102 CDD:279552 26/108 (24%)
AT5G20110NP_197511.1 Dynein_light 87..205 CDD:413603 33/122 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.