DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8407 and AT4G27360

DIOPT Version :9

Sequence 1:NP_001163124.1 Gene:CG8407 / 36303 FlyBaseID:FBgn0033687 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_194466.2 Gene:AT4G27360 / 828844 AraportID:AT4G27360 Length:103 Species:Arabidopsis thaliana


Alignment Length:82 Identity:25/82 - (30%)
Similarity:46/82 - (56%) Gaps:2/82 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TDMNEEMRIEAIELSITACEKYS-SNYEHAAKIIKENMDKKFGIYWHVVVGEGFGFEVSYETENI 87
            |||.:.|:.:|:.|:..|.:.:. :.....|:.||:..|:.:|..|..:||..||..|::.:...
plant    11 TDMKQTMKEDALSLASKALDCFDVTEPTQIARFIKKEFDRSYGSGWQCIVGTHFGSFVTHCSGCF 75

  Fly    88 LYLFFAGNLAIVLWKCS 104
            :: |..|:|.|:|:|.|
plant    76 IH-FSVGSLTILLFKGS 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8407NP_001163124.1 Dynein_light 18..102 CDD:279552 23/78 (29%)
AT4G27360NP_194466.2 Dynein_light 5..89 CDD:279552 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.