DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8407 and AT3G16120

DIOPT Version :10

Sequence 1:NP_610734.1 Gene:CG8407 / 36303 FlyBaseID:FBgn0033687 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_188233.1 Gene:AT3G16120 / 820857 AraportID:AT3G16120 Length:93 Species:Arabidopsis thaliana


Alignment Length:96 Identity:27/96 - (28%)
Similarity:50/96 - (52%) Gaps:11/96 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EGEKKIVHVYPLVKHTDMNEEMRIEAIELSITACEKYS--SNYEHAAKIIKENMDKKFGIYWHVV 71
            ||:.|       |:.|||..:|:::|::::..:.:.:.  .:...||.|.|| .|:::|..|..|
plant     3 EGKAK-------VEETDMPVKMQMQAMKIASQSLDLFDVFDSISIAAHIKKE-FDERYGSGWQCV 59

  Fly    72 VGEGFGFEVSYETENILYLFFAGNLAIVLWK 102
            ||..||...::.....:| |..|.|..:::|
plant    60 VGTNFGCFFTHSKGTFIY-FHLGTLNFLIFK 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8407NP_610734.1 DLC-like_DNAL4 20..102 CDD:412001 23/83 (28%)
AT3G16120NP_188233.1 Dynein_light 5..89 CDD:460119 24/92 (26%)

Return to query results.
Submit another query.