DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8407 and AT3G16120

DIOPT Version :9

Sequence 1:NP_001163124.1 Gene:CG8407 / 36303 FlyBaseID:FBgn0033687 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001325583.1 Gene:AT3G16120 / 820857 AraportID:AT3G16120 Length:93 Species:Arabidopsis thaliana


Alignment Length:96 Identity:27/96 - (28%)
Similarity:50/96 - (52%) Gaps:11/96 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EGEKKIVHVYPLVKHTDMNEEMRIEAIELSITACEKYS--SNYEHAAKIIKENMDKKFGIYWHVV 71
            ||:.|       |:.|||..:|:::|::::..:.:.:.  .:...||.|.|| .|:::|..|..|
plant     3 EGKAK-------VEETDMPVKMQMQAMKIASQSLDLFDVFDSISIAAHIKKE-FDERYGSGWQCV 59

  Fly    72 VGEGFGFEVSYETENILYLFFAGNLAIVLWK 102
            ||..||...::.....:| |..|.|..:::|
plant    60 VGTNFGCFFTHSKGTFIY-FHLGTLNFLIFK 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8407NP_001163124.1 Dynein_light 18..102 CDD:279552 23/85 (27%)
AT3G16120NP_001325583.1 Dynein_light 5..89 CDD:395977 24/92 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.