DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8407 and Dynll1

DIOPT Version :9

Sequence 1:NP_001163124.1 Gene:CG8407 / 36303 FlyBaseID:FBgn0033687 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_445771.1 Gene:Dynll1 / 58945 RGDID:619866 Length:89 Species:Rattus norvegicus


Alignment Length:83 Identity:35/83 - (42%)
Similarity:57/83 - (68%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LVKHTDMNEEMRIEAIELSITACEKYSSNYEHAAKIIKENMDKKFGIYWHVVVGEGFGFEVSYET 84
            ::|:.||:|||:.:::|.:..|.|||:...:.||.|.|| .|||:...||.:||..||..|::||
  Rat     7 VIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKE-FDKKYNPTWHCIVGRNFGSYVTHET 70

  Fly    85 ENILYLFFAGNLAIVLWK 102
            ::.:| |:.|.:||:|:|
  Rat    71 KHFIY-FYLGQVAILLFK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8407NP_001163124.1 Dynein_light 18..102 CDD:279552 34/81 (42%)
Dynll1NP_445771.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 35/83 (42%)
Interaction with ESR1. /evidence=ECO:0000250 67..89 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.