Sequence 1: | NP_001163124.1 | Gene: | CG8407 / 36303 | FlyBaseID: | FBgn0033687 | Length: | 104 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_062656.3 | Gene: | Dynll1 / 56455 | MGIID: | 1861457 | Length: | 89 | Species: | Mus musculus |
Alignment Length: | 83 | Identity: | 35/83 - (42%) |
---|---|---|---|
Similarity: | 57/83 - (68%) | Gaps: | 2/83 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 LVKHTDMNEEMRIEAIELSITACEKYSSNYEHAAKIIKENMDKKFGIYWHVVVGEGFGFEVSYET 84
Fly 85 ENILYLFFAGNLAIVLWK 102 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8407 | NP_001163124.1 | Dynein_light | 18..102 | CDD:279552 | 34/81 (42%) |
Dynll1 | NP_062656.3 | DLC-like_DYNLL1_DYNLL2 | 5..88 | CDD:412000 | 35/83 (42%) |
Interaction with ESR1. /evidence=ECO:0000250 | 67..89 | 9/22 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3430 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |