DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8407 and Dnal4

DIOPT Version :9

Sequence 1:NP_001163124.1 Gene:CG8407 / 36303 FlyBaseID:FBgn0033687 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_059498.2 Gene:Dnal4 / 54152 MGIID:1859217 Length:105 Species:Mus musculus


Alignment Length:105 Identity:62/105 - (59%)
Similarity:83/105 - (79%) Gaps:1/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADEEAGK-EGEKKIVHVYPLVKHTDMNEEMRIEAIELSITACEKYSSNYEHAAKIIKENMDKKF 64
            |.:.|..| |.:.|.:..:|||:|:||.||||:|.:||.:|||||:|:|.|.|||:|||.|||||
Mouse     1 MGETEGKKEEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKF 65

  Fly    65 GIYWHVVVGEGFGFEVSYETENILYLFFAGNLAIVLWKCS 104
            |..||||:|||||||:::|.:|:|||:|.|.||:.:||||
Mouse    66 GSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8407NP_001163124.1 Dynein_light 18..102 CDD:279552 53/83 (64%)
Dnal4NP_059498.2 DLC-like_DNAL4 21..103 CDD:412001 52/81 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 130 1.000 Domainoid score I5195
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38094
Inparanoid 1 1.050 139 1.000 Inparanoid score I4503
Isobase 1 0.950 - 0 Normalized mean entropy S1783
OMA 1 1.010 - - QHG56316
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 1 1.000 - - FOG0007205
OrthoInspector 1 1.000 - - oto92487
orthoMCL 1 0.900 - - OOG6_105070
Panther 1 1.100 - - LDO PTHR11886
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4867
SonicParanoid 1 1.000 - - X5314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.820

Return to query results.
Submit another query.