DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8407 and dynll1

DIOPT Version :9

Sequence 1:NP_001163124.1 Gene:CG8407 / 36303 FlyBaseID:FBgn0033687 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001005077.1 Gene:dynll1 / 448652 XenbaseID:XB-GENE-854521 Length:89 Species:Xenopus tropicalis


Alignment Length:92 Identity:36/92 - (39%)
Similarity:60/92 - (65%) Gaps:7/92 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EKKIVHVYPLVKHTDMNEEMRIEAIELSITACEKYSSNYEHAAKIIKENMDKKFGIYWHVVVGEG 75
            |:|.|     :|:.||:|||:.:|::.:..|.||::...:.|| .||:..|||:...||.:||..
 Frog     3 ERKAV-----IKNADMSEEMQQDAVDCATQALEKFNIEKDIAA-FIKKEFDKKYNPTWHCIVGRN 61

  Fly    76 FGFEVSYETENILYLFFAGNLAIVLWK 102
            ||..|::||::.:| |:.|.:||:|:|
 Frog    62 FGSYVTHETKHFIY-FYLGQVAILLFK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8407NP_001163124.1 Dynein_light 18..102 CDD:279552 32/83 (39%)
dynll1NP_001005077.1 PTZ00059 1..89 CDD:185421 36/92 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.