DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8407 and dnal4a

DIOPT Version :9

Sequence 1:NP_001163124.1 Gene:CG8407 / 36303 FlyBaseID:FBgn0033687 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001003603.1 Gene:dnal4a / 445209 ZFINID:ZDB-GENE-040801-122 Length:106 Species:Danio rerio


Alignment Length:106 Identity:63/106 - (59%)
Similarity:85/106 - (80%) Gaps:2/106 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADEEAGK--EGEKKIVHVYPLVKHTDMNEEMRIEAIELSITACEKYSSNYEHAAKIIKENMDKK 63
            ||:...||  :.:.|.:..:||::||||.||||:|.:||.:|||||::||.|.|||:|||:||||
Zfish     1 MAETGDGKKEDADYKRLQSFPLIRHTDMPEEMRVETMELCVTACEKFASNNESAAKMIKESMDKK 65

  Fly    64 FGIYWHVVVGEGFGFEVSYETENILYLFFAGNLAIVLWKCS 104
            ||..||||:||||||||::|..|:||:||.|:||:.:||||
Zfish    66 FGSSWHVVIGEGFGFEVTHEVRNLLYMFFGGSLAVCVWKCS 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8407NP_001163124.1 Dynein_light 18..102 CDD:279552 54/83 (65%)
dnal4aNP_001003603.1 Dynein_light 21..104 CDD:279552 54/82 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575696
Domainoid 1 1.000 132 1.000 Domainoid score I5072
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4441
OMA 1 1.010 - - QHG56316
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 1 1.000 - - FOG0007205
OrthoInspector 1 1.000 - - otm26028
orthoMCL 1 0.900 - - OOG6_105070
Panther 1 1.100 - - O PTHR11886
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5314
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.