DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8407 and dynll1

DIOPT Version :9

Sequence 1:NP_001163124.1 Gene:CG8407 / 36303 FlyBaseID:FBgn0033687 Length:104 Species:Drosophila melanogaster
Sequence 2:XP_021333906.1 Gene:dynll1 / 406297 ZFINID:ZDB-GENE-040426-1961 Length:137 Species:Danio rerio


Alignment Length:102 Identity:38/102 - (37%)
Similarity:62/102 - (60%) Gaps:15/102 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADEEAGKEGEKKIVHVYPLVKHTDMNEEMRIEAIELSITACEKYSSNYEHAAKIIKENMDKKFG 65
            |:|.:|             ::|:.||:|||:.:|:|.:..|.|||:...:.|| .||:..|||:.
Zfish    49 MSDRKA-------------VIKNADMSEEMQQDAVECATQALEKYNIEKDIAA-YIKKEFDKKYN 99

  Fly    66 IYWHVVVGEGFGFEVSYETENILYLFFAGNLAIVLWK 102
            ..||.:||..||..|::||::.:| |:.|.:||:|:|
Zfish   100 PTWHCIVGRNFGSYVTHETKHFIY-FYLGQVAILLFK 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8407NP_001163124.1 Dynein_light 18..102 CDD:279552 34/83 (41%)
dynll1XP_021333906.1 PTZ00059 49..137 CDD:185421 38/102 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.