DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8407 and dlc-4

DIOPT Version :9

Sequence 1:NP_001163124.1 Gene:CG8407 / 36303 FlyBaseID:FBgn0033687 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_001023431.2 Gene:dlc-4 / 3565151 WormBaseID:WBGene00012425 Length:129 Species:Caenorhabditis elegans


Alignment Length:51 Identity:14/51 - (27%)
Similarity:27/51 - (52%) Gaps:5/51 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AKIIKENMDKKFGIYWHVVVGEGFGFEVSYETENILYLFF-AGNLAIVLWK 102
            |..:|...|.|:|.:|..|||..||..:    :.|.::.| ...::::|::
 Worm    83 ASFMKRKFDAKYGGHWQCVVGRNFGSHL----DPIQFIHFTVSKISVILFR 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8407NP_001163124.1 Dynein_light 18..102 CDD:279552 14/49 (29%)
dlc-4NP_001023431.2 Dynein_light 49..129 CDD:279552 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3430
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1520814at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.