DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8407 and Cdlc2

DIOPT Version :10

Sequence 1:NP_610734.1 Gene:CG8407 / 36303 FlyBaseID:FBgn0033687 Length:104 Species:Drosophila melanogaster
Sequence 2:NP_477408.1 Gene:Cdlc2 / 33319 FlyBaseID:FBgn0026141 Length:89 Species:Drosophila melanogaster


Alignment Length:102 Identity:37/102 - (36%)
Similarity:61/102 - (59%) Gaps:15/102 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADEEAGKEGEKKIVHVYPLVKHTDMNEEMRIEAIELSITACEKYSSNYEHAAKIIKENMDKKFG 65
            |:|.:|             ::|:.||:|||:.:|::.:..|.|||:...:.|| .||:..|||:.
  Fly     1 MSDRKA-------------VIKNADMSEEMQQDAVDCATQALEKYNIEKDIAA-FIKKEFDKKYN 51

  Fly    66 IYWHVVVGEGFGFEVSYETENILYLFFAGNLAIVLWK 102
            ..||.:||..||..|::||.:.:| |:.|.:||:|:|
  Fly    52 PTWHCIVGRNFGSYVTHETRHFIY-FYLGQVAILLFK 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8407NP_610734.1 DLC-like_DNAL4 20..102 CDD:412001 33/81 (41%)
Cdlc2NP_477408.1 DLC-like_DYNLL1_DYNLL2 5..88 CDD:412000 35/98 (36%)

Return to query results.
Submit another query.