DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and YCK2

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_014245.1 Gene:YCK2 / 855568 SGDID:S000005098 Length:546 Species:Saccharomyces cerevisiae


Alignment Length:430 Identity:87/430 - (20%)
Similarity:161/430 - (37%) Gaps:119/430 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 VFLIDFGLASKFQDRGVHRPFIMDQRRAHDGTLEFTSRDAHLG-AHSRRSDLECLGYNLLYWSEG 584
            |.|||||:|.:::|....:.....::::..||..:.|.:.||| ..|||.|:|.:|:...|:..|
Yeast   214 VHLIDFGMAKQYRDPKTKQHIPYREKKSLSGTARYMSINTHLGREQSRRDDMEAMGHVFFYFLRG 278

  Fly   585 YLPWKDVA---QQQQQEKVHRAKELFMTDVPEMLRQFYGKQVPKYLGEFLLQIGQLAYQERPNYE 646
            .|||:.:.   .:|:.||:...|.|  |:|.::     .:.:|...|.:|..:..|:::|.|:||
Yeast   279 QLPWQGLKAPNNKQKYEKIGEKKRL--TNVYDL-----AQGLPIQFGRYLEIVRNLSFEETPDYE 336

  Fly   647 RYRKIFKREYQRLGYDPCQMRLSSEEILRTCVSTKDVVDGSKCDIFELNNKAAVNVMRNSTLSTP 711
            .||.:.......||                     :..|| :.|..:||.....::..|...:..
Yeast   337 GYRMLLLSVLDDLG---------------------ETADG-QYDWMKLNGGRGWDLSINKKPNLH 379

  Fly   712 FQEHSLTNRVSPKNLRSKSNKKTTKKKFSWAEVLSQDPDQIARERAVKEFEREETICPLESRLPR 776
            ...|.     :|.|.:||.::....:..|        ||.                         
Yeast   380 GYGHP-----NPPNEKSKRHRSKNHQYSS--------PDH------------------------- 406

  Fly   777 RYEGKPTYAILDMEQRRREKGLVVQEHIEEEEEDADEDDEEENQEAMDIDQEEDGEAADSAEGED 841
                                    ..|..::::......:.:.|....:.|::    ...|:.:.
Yeast   407 ------------------------HHHYNQQQQQQQAQAQAQAQAQAKVQQQQ----LQQAQAQQ 443

  Fly   842 ESDRSMEGSDCSDHSQKRARGRPKGTS----RKQTTSRQAQPHQNQPPVKVHRGVGRPGKNSGVV 902
            :::|.....|.|.:.::|...:...||    ::||..:.||..|.|...|     .:...|:|  
Yeast   444 QANRYQLQPDDSHYDEEREASKLDPTSYEAYQQQTQQKYAQQQQKQMQQK-----SKQFANTG-- 501

  Fly   903 KLAAGAVSKNRTTPLSA--VASNKRGC--ATRKENSTLAS 938
              |.|..:|   .|.:|  .|::::..  |.:..||..:|
Yeast   502 --ANGQTNK---YPYNAQPTANDEQNAKNAAQDRNSNKSS 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357
SPS1 123..>284 CDD:223589
SPS1 <491..756 CDD:223589 58/238 (24%)
PKc_like <517..652 CDD:304357 42/134 (31%)
YCK2NP_014245.1 STKc_CK1_fungal 75..351 CDD:271029 44/164 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.