DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsd and AT5G18190

DIOPT Version :10

Sequence 1:NP_610733.1 Gene:bsd / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_197320.1 Gene:AT5G18190 / 831937 AraportID:AT5G18190 Length:691 Species:Arabidopsis thaliana


Alignment Length:204 Identity:61/204 - (29%)
Similarity:93/204 - (45%) Gaps:39/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 QKLRSRGSKHLDNNPTEYKFL-----PTEEEHVFLIDFGLASKFQD--RGVHRPFIMDQR-RAHD 550
            :||..:|..|.|..|.  .||     ..:|:.::|||.|||||::|  .|.|..:  ||| ....
plant   248 EKLHMKGFVHGDVKPE--NFLLGQPGTADEKKLYLIDLGLASKWKDSHSGQHVEY--DQRPDVFR 308

  Fly   551 GTLEFTSRDAHLG-AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEM 614
            ||:.:.|..|||| ..|||.|||.|.|.|::..:|.|||:......:...|.:.|   |:..||:
plant   309 GTIRYASVHAHLGRTGSRRDDLESLAYTLIFLLKGRLPWQGYQGDNKSFLVCKKK---MSTSPEL 370

  Fly   615 LRQFYGKQVPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLGYDPCQMRLSSEEILRTCVS 679
            :..|    .|.....||..:..:.:.|.|||.:...||                  :.::..|..
plant   371 MCCF----CPPPFKLFLEAVTNMKFDEEPNYAKLISIF------------------DSLIEQCAL 413

  Fly   680 TKDV-VDGS 687
            ::.: :||:
plant   414 SRPIKIDGA 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsdNP_610733.1 Protein Kinases, catalytic domain 112..>286 CDD:473864
Protein Kinases, catalytic domain <517..652 CDD:473864 48/138 (35%)
AT5G18190NP_197320.1 STKc_CK1 130..404 CDD:270918 56/166 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.