DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and ckl4

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_194615.2 Gene:ckl4 / 829007 AraportID:AT4G28860 Length:414 Species:Arabidopsis thaliana


Alignment Length:262 Identity:71/262 - (27%)
Similarity:113/262 - (43%) Gaps:36/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 DQKL------RSRGSKHLDNNPTEYKF-LPTEEEHVFLIDFGLASKFQDRGVHRPFIMDQRRAHD 550
            ||.|      .|:|..|.|..|..:.. |..:...|:|||||||.:::|...:|.....:.:...
plant   110 DQMLTRIEYVHSKGYLHRDIKPDNFLMGLGRKANQVYLIDFGLAKRYRDANTNRHIPYRENKNLT 174

  Fly   551 GTLEFTSRDAHLG-AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEM 614
            ||..:.|.:.||| ...||.|||.|||.|||:..|.|||:.:....:::|..:..|..::...|:
plant   175 GTARYASCNTHLGIEQGRRDDLESLGYVLLYFLRGSLPWQGLKAVDKKQKYDKICEKKISTPIEV 239

  Fly   615 LRQFYGKQVPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLG------YDPCQMRLSSEEI 673
            |    .|..|.....:......|.:.:||:|...:::|:..:.|.|      ||...::....:.
plant   240 L----CKSHPVEFASYFHYCHTLTFDQRPDYGFLKRLFRDLFSREGYEFDYIYDWTIIKYQQSQK 300

  Fly   674 LRTCVSTKDVVDGSKCDIFELNNKAAV-----NVMRNSTLSTPFQEHSLTNRVSPKNLRSKSNKK 733
            .|   |....|.||       :|..|:     |....:.:|   .|..:::||.|.|....|.:.
plant   301 TR---SQSQAVPGS-------SNARAIPMDTSNHRGGTKIS---HEAQVSDRVRPANASGPSPQI 352

  Fly   734 TT 735
            .|
plant   353 NT 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357
SPS1 123..>284 CDD:223589
SPS1 <491..756 CDD:223589 71/262 (27%)
PKc_like <517..652 CDD:304357 41/135 (30%)
ckl4NP_194615.2 PKc_like 8..282 CDD:419665 52/175 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.