DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsd and AT4G08800

DIOPT Version :10

Sequence 1:NP_610733.1 Gene:bsd / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_192620.1 Gene:AT4G08800 / 826451 AraportID:AT4G08800 Length:285 Species:Arabidopsis thaliana


Alignment Length:173 Identity:46/173 - (26%)
Similarity:82/173 - (47%) Gaps:22/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 LRSRGSKHLDNNPTEYKFLPTEEEHVFLI------DFGLASKFQDRGVHRPFIMDQRRAHDGTLE 554
            :.|:...|.|..|..           ||:      |||||.|::|...:|.....:.::..||..
plant    93 IHSKSFLHRDIKPDN-----------FLMGKAGKSDFGLARKYRDSSSYRHIPYRENKSLTGTPA 146

  Fly   555 FTSRDAHLG-AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQF 618
            :.|.:.||| ..|||.|:|.|||.|:|:.:|.||||.:....:::|..:..|..::...|.|.:.
plant   147 YASLNTHLGIEQSRRDDVESLGYILMYFLKGSLPWKGLKAGNKKQKYDKISEKKVSTSIETLCEG 211

  Fly   619 YGKQVPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLGY 661
            :    |.....::.....|.:.::|:|...:::|:..:.|.|:
plant   212 H----PIEFATYIHYCRSLRFDDKPDYAYLKRLFRDLFIREGF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsdNP_610733.1 Protein Kinases, catalytic domain 112..>286 CDD:473864
Protein Kinases, catalytic domain <517..652 CDD:473864 39/141 (28%)
AT4G08800NP_192620.1 Protein Kinases, catalytic domain 8..250 CDD:473864 45/171 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.