DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and AT4G08800

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_192620.1 Gene:AT4G08800 / 826451 AraportID:AT4G08800 Length:285 Species:Arabidopsis thaliana


Alignment Length:173 Identity:46/173 - (26%)
Similarity:82/173 - (47%) Gaps:22/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 LRSRGSKHLDNNPTEYKFLPTEEEHVFLI------DFGLASKFQDRGVHRPFIMDQRRAHDGTLE 554
            :.|:...|.|..|..           ||:      |||||.|::|...:|.....:.::..||..
plant    93 IHSKSFLHRDIKPDN-----------FLMGKAGKSDFGLARKYRDSSSYRHIPYRENKSLTGTPA 146

  Fly   555 FTSRDAHLG-AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQF 618
            :.|.:.||| ..|||.|:|.|||.|:|:.:|.||||.:....:::|..:..|..::...|.|.:.
plant   147 YASLNTHLGIEQSRRDDVESLGYILMYFLKGSLPWKGLKAGNKKQKYDKISEKKVSTSIETLCEG 211

  Fly   619 YGKQVPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLGY 661
            :    |.....::.....|.:.::|:|...:::|:..:.|.|:
plant   212 H----PIEFATYIHYCRSLRFDDKPDYAYLKRLFRDLFIREGF 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357
SPS1 123..>284 CDD:223589
SPS1 <491..756 CDD:223589 46/173 (27%)
PKc_like <517..652 CDD:304357 39/141 (28%)
AT4G08800NP_192620.1 PKc_like 8..250 CDD:304357 45/171 (26%)
SPS1 8..>205 CDD:223589 37/122 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.