DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and ckl10

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_188976.1 Gene:ckl10 / 821915 AraportID:AT3G23340 Length:442 Species:Arabidopsis thaliana


Alignment Length:341 Identity:83/341 - (24%)
Similarity:143/341 - (41%) Gaps:48/341 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 NGDQKLRSRGSKHLDNNPTEYKF-LPTEEEHVFLIDFGLASKFQDRGVHRPFIMDQRRAHDGTLE 554
            |..:.:.|||..|.|..|..:.. |..:...|::||:|||.|::|...|:.....:.:...||..
plant   114 NRVEYMHSRGFLHRDIKPDNFLMGLGRKANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTAR 178

  Fly   555 FTSRDAHLG-AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQF 618
            :.|.:.||| ..|||.|||.|||.|:|:..|.|||:.:....:::|..:..|..|....|:|.:.
plant   179 YASVNTHLGIEQSRRDDLESLGYVLMYFIRGSLPWQGLKAGTKKQKYEKISEKKMLTPVEVLCKS 243

  Fly   619 YGKQVPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLGYD------------PCQMRLSSE 671
            |    |.....:......|.::::|:|...:::|:..:.|.||.            |     .|.
plant   244 Y----PSEFTSYFHYCRSLRFEDKPDYSYLKRLFRDLFIREGYQFDYVFDWTILKYP-----QSG 299

  Fly   672 EILRTCVSTKDVVD--GSKCDIFELNNKAAVNVMRNSTLSTPFQEHSLTN----RVSPKNLRSK- 729
            .|.:...:.|..:|  |...   |.|.|..|........|...:..:..|    .:.||::.|. 
plant   300 SISKPRPNPKPALDPPGPSA---ERNEKPIVGQDLRERFSGAVEAFARRNVPSHGIRPKHIFSDD 361

  Fly   730 -------SNKKTTKKKFSWAEVLSQDP---DQIARERAVKEFERE-ETICPL-ESRLPRRY---E 779
                   |.|...:.....|.:.|..|   .:::..|:.|.|... :.|.|: |::|..|.   :
plant   362 ASKEVQVSEKTRNEIATKMAVMSSSQPGSSGELSENRSSKLFSSSAQKIQPVQETKLSARLGRDD 426

  Fly   780 GKPTYAILDMEQRRRE 795
            |..::.:|.:...:|:
plant   427 GLRSFDMLTIGSGKRK 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357
SPS1 123..>284 CDD:223589
SPS1 <491..756 CDD:223589 72/295 (24%)
PKc_like <517..652 CDD:304357 40/135 (30%)
ckl10NP_188976.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 50/171 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.