DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsd and AT2G25760

DIOPT Version :10

Sequence 1:NP_610733.1 Gene:bsd / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_973532.1 Gene:AT2G25760 / 817118 AraportID:AT2G25760 Length:676 Species:Arabidopsis thaliana


Alignment Length:333 Identity:84/333 - (25%)
Similarity:125/333 - (37%) Gaps:102/333 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 QKLRSRGSKHLDNNPTEYKFLP---TEEEHVFLIDFGLASKFQD--RGVHRPFIMDQR-RAHDGT 552
            :|:.|||..|.|..|..:...|   .||:.:||:|.|||||::|  .|:|..:  ||| ....||
plant   227 EKMHSRGYVHGDVKPENFLLGPPGTPEEKKLFLVDLGLASKWRDTATGLHVEY--DQRPDVFRGT 289

  Fly   553 LEFTSRDAHLG-AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLR 616
            :.:.|..|||| ..|||.|||.|.|.|::...|.|||:.......:.|.....:..|...||.|.
plant   290 VRYASVHAHLGRTCSRRDDLESLAYTLVFLLRGRLPWQGYQVGDTKNKGFLVCKKKMATSPETLC 354

  Fly   617 QFYGKQVPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLGYDPCQMRLSSEEILRTCVSTK 681
            .|    .|:...:|:..:..|.:.|.|:|.:|..:|                             
plant   355 CF----CPQPFRQFVEYVVNLKFDEEPDYAKYVSLF----------------------------- 386

  Fly   682 DVVDGSKCDIFELNNKAAVNVMRNSTLSTPFQEHSLTNRVSPKNLR---SKSNKKTTKK------ 737
            |.:.|...||..:|.:.|               ..|.::|..|..|   .:.:::.|||      
plant   387 DGIVGPNPDIRPINTEGA---------------QKLIHQVGQKRGRLTMDEEDEQPTKKIRLGMP 436

  Fly   738 KFSWAEVLSQDPDQIARERAVKEFEREETICPLESRLPRRYEGKPTYAILDMEQRRREKGLVVQE 802
            ...|..:.|       ..|.:|:                ||.    |.:.|..         :.:
plant   437 ATQWISIYS-------AHRPMKQ----------------RYH----YNVTDTR---------LAQ 465

  Fly   803 HIEEEEED 810
            |||:..||
plant   466 HIEKGNED 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsdNP_610733.1 Protein Kinases, catalytic domain 112..>286 CDD:473864
Protein Kinases, catalytic domain <517..652 CDD:473864 49/138 (36%)
AT2G25760NP_973532.1 STKc_CK1 106..386 CDD:270918 57/164 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.