DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and AT2G25760

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_973532.1 Gene:AT2G25760 / 817118 AraportID:AT2G25760 Length:676 Species:Arabidopsis thaliana


Alignment Length:333 Identity:84/333 - (25%)
Similarity:125/333 - (37%) Gaps:102/333 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 QKLRSRGSKHLDNNPTEYKFLP---TEEEHVFLIDFGLASKFQD--RGVHRPFIMDQR-RAHDGT 552
            :|:.|||..|.|..|..:...|   .||:.:||:|.|||||::|  .|:|..:  ||| ....||
plant   227 EKMHSRGYVHGDVKPENFLLGPPGTPEEKKLFLVDLGLASKWRDTATGLHVEY--DQRPDVFRGT 289

  Fly   553 LEFTSRDAHLG-AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLR 616
            :.:.|..|||| ..|||.|||.|.|.|::...|.|||:.......:.|.....:..|...||.|.
plant   290 VRYASVHAHLGRTCSRRDDLESLAYTLVFLLRGRLPWQGYQVGDTKNKGFLVCKKKMATSPETLC 354

  Fly   617 QFYGKQVPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLGYDPCQMRLSSEEILRTCVSTK 681
            .|    .|:...:|:..:..|.:.|.|:|.:|..:|                             
plant   355 CF----CPQPFRQFVEYVVNLKFDEEPDYAKYVSLF----------------------------- 386

  Fly   682 DVVDGSKCDIFELNNKAAVNVMRNSTLSTPFQEHSLTNRVSPKNLR---SKSNKKTTKK------ 737
            |.:.|...||..:|.:.|               ..|.::|..|..|   .:.:::.|||      
plant   387 DGIVGPNPDIRPINTEGA---------------QKLIHQVGQKRGRLTMDEEDEQPTKKIRLGMP 436

  Fly   738 KFSWAEVLSQDPDQIARERAVKEFEREETICPLESRLPRRYEGKPTYAILDMEQRRREKGLVVQE 802
            ...|..:.|       ..|.:|:                ||.    |.:.|..         :.:
plant   437 ATQWISIYS-------AHRPMKQ----------------RYH----YNVTDTR---------LAQ 465

  Fly   803 HIEEEEED 810
            |||:..||
plant   466 HIEKGNED 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357
SPS1 123..>284 CDD:223589
SPS1 <491..756 CDD:223589 73/277 (26%)
PKc_like <517..652 CDD:304357 49/138 (36%)
AT2G25760NP_973532.1 STKc_CK1 106..386 CDD:270918 57/164 (35%)
Pkinase 107..366 CDD:278497 52/144 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.