DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and VRK1

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:XP_006720310.1 Gene:VRK1 / 7443 HGNCID:12718 Length:420 Species:Homo sapiens


Alignment Length:763 Identity:151/763 - (19%)
Similarity:230/763 - (30%) Gaps:380/763 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 GTILRDVLSKAWRLGRPIGKGNFGEIFLASDDTVCPASSET----AKYVVKIEPHSNGPLFVEIH 172
            |.|:.|:..|.|::|.|||:|.||.|:||..:     |||:    |..|||:||..|||||.|:.
Human    26 GEIITDMAKKEWKVGLPIGQGGFGCIYLADMN-----SSESVGSDAPCVVKVEPSDNGPLFTELK 85

  Fly   173 CLINTSRNNDLSDAAEDAASLPAPQTHVLSRG-PPSGIPSFIASGTHYFGDVRYRFLVLPRFDRD 236
            ..             :.||.....|..:.:|. ...|:|.:..||.|......|||:::.||..|
Human    86 FY-------------QRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSD 137

  Fly   237 LHSLIKNS--RVQQKSLLVLAVHIINVLENLHDKGYCHNDIKAQNLMVSKCKYLRRQVVPKGNGY 299
            |..:.:.:  |..:|::|.|::.|:::||.:|:..|.|.||||.||:                  
Human   138 LQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLL------------------ 184

  Fly   300 EDHYEEKQQTTDSGNSSEQETNDDDYFLKSEKFALKKIVDIKQDEDEDDEDFDDGATSNSNNSNS 364
                                                                             
Human   185 ----------------------------------------------------------------- 184

  Fly   365 LDVFHTPVNKKRSARNAIQFSGSNPVRACRREKRNSMYEEMVKSHYLRPTKRISYREEFNEDGYP 429
                                                                ::|:         
Human   185 ----------------------------------------------------LNYK--------- 188

  Fly   430 KETAENSDESPESSDNESDEFIPPSSRRSVIKRGRSAQIATPKKTPVSTRASRQEKVKKEPNGDQ 494
                                                                             
Human   189 ----------------------------------------------------------------- 188

  Fly   495 KLRSRGSKHLDNNPTEYKFLPTEEEHVFLIDFGLASKFQDRGVHRPFIMDQRRAHDGTLEFTSRD 559
                        ||          :.|:|:|:|||.::...|||:.:..|.:|.||||:||||.|
Human   189 ------------NP----------DQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSID 231

  Fly   560 AHLG-AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEML-RQFYGKQ 622
            ||.| |.|||.|||.|||.::.|..|:|||:|  ..:..:.|..:|..:..::..:: :.|..|.
Human   232 AHNGVAPSRRGDLEILGYCMIQWLTGHLPWED--NLKDPKYVRDSKIRYRENIASLMDKCFPEKN 294

  Fly   623 VPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLGYDPCQMRLSSEEILRTCVSTKDVVDGS 687
            .|..:.:::..:..|.|.|:|.||..|.|..:..:.:|                   :||  || 
Human   295 KPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIG-------------------SKD--DG- 337

  Fly   688 KCDIFELNNKAAVNVMRNSTLSTPFQEHSLTNRVSPKNLRSKSNKKTTKKKFSWAEVLSQDPDQI 752
                     |..::|:.|..|..                      ||..||              
Human   338 ---------KLDLSVVENGGLKA----------------------KTITKK-------------- 357

  Fly   753 ARERAVKEFEREETICPLESRLPRRYEGKPTYAILDMEQRRREKGLVVQEHIEEEEEDADEDDEE 817
                                                   |::|        |||.:|...||.|.
Human   358 ---------------------------------------RKKE--------IEESKEPGVEDTEW 375

  Fly   818 ENQEAMDIDQEEDGEAADSAEGEDESDRSMEGSDCSDHSQKRARGRPK 865
            .|      .|.|:.....|.|.:....|||...:.|..|...:|.|.:
Human   376 SN------TQTEEAIQTRSEESQGAIHRSMSQPEASSSSYDSSRTRKR 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 62/180 (34%)
SPS1 123..>284 CDD:223589 58/167 (35%)
SPS1 <491..756 CDD:223589 67/266 (25%)
PKc_like <517..652 CDD:304357 51/136 (38%)
VRK1XP_006720310.1 STKc_VRK1 26..326 CDD:271024 117/550 (21%)
S_TKc 37..293 CDD:214567 103/506 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371612at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.