DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and Csnk1g3

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_074046.1 Gene:Csnk1g3 / 64823 RGDID:621408 Length:448 Species:Rattus norvegicus


Alignment Length:575 Identity:97/575 - (16%)
Similarity:162/575 - (28%) Gaps:292/575 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 RPSVVNGTILRDVLSKA---------WRLGRPIGKGNFGEIFLASDDTVCPASSETAKYV-VKIE 160
            |||..:|...|...|.:         :|:|:.||.|||||:.|..       :..|.:|| :|:|
  Rat    17 RPSGRSGHSTRGTGSSSSGVLMVGPNFRVGKKIGCGNFGELRLGK-------NLYTNEYVAIKLE 74

  Fly   161 PHSNGPLFVEIHCLINTSRNNDLSDAAEDAASLPAPQTHVLSR-----GPPSGIPSFIASGTHYF 220
            |..              ||               |||.|:..|     |...|||.     .:||
  Rat    75 PMK--------------SR---------------APQLHLEYRFYKQLGSGDGIPQ-----VYYF 105

  Fly   221 GDV-RYRFLVLPRFDRDLHSL--IKNSRVQQKSLLVLAVHIINVLENLHDKGYCHNDIKAQNLMV 282
            |.. :|..:||......|..|  :.:.....|::|::|:.:|:.:|.:|.|...:.|:|.:|.::
  Rat   106 GPCGKYNAMVLELLGPSLEDLFDLCDRTFSLKTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLI 170

  Fly   283 SKCKYLRRQVVPKGNGYEDHYEEKQQTTDSGNSSEQETNDDDYFLKSEKFALKKIVDIKQDEDED 347
            .:                           .||.::|                             
  Rat   171 GR---------------------------PGNKAQQ----------------------------- 179

  Fly   348 DEDFDDGATSNSNNSNSLDVFHTPVNKKRSARNAIQFSGSNPVRACRREKRNSMYEEMVKSHYLR 412
                               |.|                                           
  Rat   180 -------------------VIH------------------------------------------- 182

  Fly   413 PTKRISYREEFNEDGYPKETAENSDESPESSDNESDEFIPPSSRRSVIKRGRSAQIATPKKTPVS 477
                                                                             
  Rat   183 ----------------------------------------------------------------- 182

  Fly   478 TRASRQEKVKKEPNGDQKLRSRGSKHLDNNPTEYKFLPTEEEHVFLIDFGLASKFQDRGVHRPFI 542
                                                         :||||||.::.|....:...
  Rat   183 ---------------------------------------------IIDFGLAKEYIDPETKKHIP 202

  Fly   543 MDQRRAHDGTLEFTSRDAHLG-AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKEL 606
            ..:.::..||..:.|.:.||| ..|||.|||.||:..:|:..|.|||:.:.....:|:..:..:.
  Rat   203 YREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDT 267

  Fly   607 FMTDVPEMLRQFYGKQVPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLGY 661
            ......|:|.:.:    |:.:..:|..:.:|.:.|:|:|:..||:|...:.|.||
  Rat   268 KRATPIEVLCENF----PEEMATYLRYVRRLDFFEKPDYDYLRKLFTDLFDRKGY 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 48/191 (25%)
SPS1 123..>284 CDD:223589 45/169 (27%)
SPS1 <491..756 CDD:223589 41/172 (24%)
PKc_like <517..652 CDD:304357 37/135 (27%)
Csnk1g3NP_074046.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 6/17 (35%)
STKc_CK1_gamma 42..329 CDD:271028 91/550 (17%)
CK1gamma_C 329..418 CDD:403712
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 342..375
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 392..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.