DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and CSNK1G1

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001316534.1 Gene:CSNK1G1 / 53944 HGNCID:2454 Length:475 Species:Homo sapiens


Alignment Length:577 Identity:92/577 - (15%)
Similarity:164/577 - (28%) Gaps:292/577 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RPVYTLRPSVVNGTILRDVLSKAWRLGRPIGKGNFGEIFLASDDTVCPASSETAKYV-VKIEPHS 163
            |..:..|||..:.:....::...:|:|:.||.|||||:.|..       :..|.:|| :|:||..
Human    21 RSAHCSRPSGSSSSSGVLMVGPNFRVGKKIGCGNFGELRLGK-------NLYTNEYVAIKLEPIK 78

  Fly   164 NGPLFVEIHCLINTSRNNDLSDAAEDAASLPAPQTHVLSR------GPPSGIPSFIASGTHYFGD 222
                          ||               |||.|:..|      ....|:|.     .:|||.
Human    79 --------------SR---------------APQLHLEYRFYKQLGSAGEGLPQ-----VYYFGP 109

  Fly   223 V-RYRFLVLPRFDRDLHSL--IKNSRVQQKSLLVLAVHIINVLENLHDKGYCHNDIKAQNLMVSK 284
            . :|..:||......|..|  :.:.....|::|::|:.:::.:|.:|.|...:.|:|.:|.::.:
Human   110 CGKYNAMVLELLGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGR 174

  Fly   285 CKYLRRQVVPKGNGYEDHYEEKQQTTDSGNSSEQETNDDDYFLKSEKFALKKIVDIKQDEDEDDE 349
                      :||                                                    
Human   175 ----------QGN---------------------------------------------------- 177

  Fly   350 DFDDGATSNSNNSNSLDVFHTPVNKKRSARNAIQFSGSNPVRACRREKRNSMYEEMVKSHYLRPT 414
                                                                             
Human   178 ----------------------------------------------------------------- 177

  Fly   415 KRISYREEFNEDGYPKETAENSDESPESSDNESDEFIPPSSRRSVIKRGRSAQIATPKKTPVSTR 479
                                                                             
Human   178 ----------------------------------------------------------------- 177

  Fly   480 ASRQEKVKKEPNGDQKLRSRGSKHLDNNPTEYKFLPTEEEHVF-LIDFGLASKFQDRGVHRPFIM 543
                                                 ::|||. :||||||.::.|....:....
Human   178 -------------------------------------KKEHVIHIIDFGLAKEYIDPETKKHIPY 205

  Fly   544 DQRRAHDGTLEFTSRDAHLG-AHSRRSDLECLGYNLLYWSEGYLPWKDV---AQQQQQEKVHRAK 604
            .:.::..||..:.|.:.||| ..|||.|||.||:..:|:..|.|||:.:   ..:::.:|:...|
Human   206 REHKSLTGTARYMSINTHLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTK 270

  Fly   605 ELFMTDVPEMLRQFYGKQVPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLGY 661
            .  .|.:..:...|     |:.:..:|..:.:|.:.|:|:||..|.:|...:::.||
Human   271 R--NTPIEALCENF-----PEEMATYLRYVRRLDFFEKPDYEYLRTLFTDLFEKKGY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 42/183 (23%)
SPS1 123..>284 CDD:223589 42/170 (25%)
SPS1 <491..756 CDD:223589 44/176 (25%)
PKc_like <517..652 CDD:304357 41/139 (29%)
CSNK1G1NP_001316534.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.