DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and VRK3

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_057524.3 Gene:VRK3 / 51231 HGNCID:18996 Length:474 Species:Homo sapiens


Alignment Length:683 Identity:127/683 - (18%)
Similarity:206/683 - (30%) Gaps:304/683 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DRSARKRKRSAVKAAEKRQRLSGGSSSANGFEFHENDDEESCSSAGSAAGTEADPPTLLHTPQ-- 75
            :.|.:|.|.|:...:.:....|.|.||         :.|::.||:..:.|:.:.|||...:||  
Human    57 ETSPKKVKWSSTVTSPRLSLFSDGDSS---------ESEDTLSSSERSKGSGSRPPTPKSSPQKT 112

  Fly    76 ARSLLLT-GASIASDHNNSSVMESPRPVYTLRPSVV--------NGTILRDVLSKAWRLGRPIGK 131
            .:|..:| |:...:..:.....:||:   ||:.|.|        .||:|.|...:.|:|.....:
Human   113 RKSPQVTRGSPQKTSCSPQKTRQSPQ---TLKRSRVTTSLEALPTGTVLTDKSGRQWKLKSFQTR 174

  Fly   132 GNFGEIFLASDDT--VCPASSETAKYVVKIEPHSNGPLFVEIHCLINTSRNNDLSDAAEDAASLP 194
            .|.|.::.|:..:  .|.:..:..|:.:|::. .:|.||.|         .|....||:   .|.
Human   175 DNQGILYEAAPTSTLTCDSGPQKQKFSLKLDA-KDGRLFNE---------QNFFQRAAK---PLQ 226

  Fly   195 APQTHVLSRGPPSGIPSFIASGTHYFGDVRYRFLVLPRFDRDLHSLIKNSR---VQQKSLLVLAV 256
            ..:...|...|...||:.:..|.|   ..:|||||||...|.|.|.:..|.   :.::|:|.:|.
Human   227 VNKWKKLYSTPLLAIPTCMGFGVH---QDKYRFLVLPSLGRSLQSALDVSPKHVLSERSVLQVAC 288

  Fly   257 HIINVLENLHDKGYCHNDIKAQNLMVSKCKYLRRQVVPKGNGYEDHYEEKQQTTDSGNSSEQETN 321
            .:::.||.||:..|.|.::.|:|:.|.                                      
Human   289 RLLDALEFLHENEYVHGNVTAENIFVD-------------------------------------- 315

  Fly   322 DDDYFLKSEKFALKKIVDIKQDEDEDDEDFDDGATSNSNNSNSLDVFHTPVNKKRSARNAIQFSG 386
                                                                             
Human   316 ----------------------------------------------------------------- 315

  Fly   387 SNPVRACRREKRNSMYEEMVKSHYLRPTKRISYREEFNEDGYPKETAENSDESPESSDNESDEFI 451
                                                                             
Human   316 ----------------------------------------------------------------- 315

  Fly   452 PPSSRRSVIKRGRSAQIATPKKTPVSTRASRQEKVKKEPNGDQKLRSRGSKHLDNNPTEYKFLPT 516
                                                                           |.
Human   316 ---------------------------------------------------------------PE 317

  Fly   517 EEEHVFLIDFGLASKFQDRGVHRPFIMDQRRAHDGTLEFTSRDAHLG-AHSRRSDLECLGYNLLY 580
            ::..|.|..:|.|.::...|.|..::...|..|:|.|||.|.|.|.| ..||||||:.|||.:|.
Human   318 DQSQVTLAGYGFAFRYCPSGKHVAYVEGSRSPHEGDLEFISMDLHKGCGPSRRSDLQSLGYCMLK 382

  Fly   581 WSEGYLPW-------KDVAQQQQQEKVHRAKELFMTDVPEMLRQFYGK-----QVPKYLGEFLLQ 633
            |..|:|||       :|:.:|:|:          ..|.|   ..|.|.     :..:.|.::|..
Human   383 WLYGFLPWTNCLPNTEDIMKQKQK----------FVDKP---GPFVGPCGHWIRPSETLQKYLKV 434

  Fly   634 IGQLAYQERPNYERYRKIFKREYQRL---GYDP 663
            :..|.|:|:|.|...|...:...|.|   .|||
Human   435 VMALTYEEKPPYAMLRNNLEALLQDLRVSPYDP 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 49/178 (28%)
SPS1 123..>284 CDD:223589 45/165 (27%)
SPS1 <491..756 CDD:223589 52/189 (28%)
PKc_like <517..652 CDD:304357 46/147 (31%)
VRK3NP_057524.3 zinc_ribbon_2 4..26 CDD:289981
DZR 5..>31 CDD:289539
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..152 26/106 (25%)
Nuclear localization signal. /evidence=ECO:0000269|PubMed:14645249 49..64 2/6 (33%)
DUF4551 <82..>150 CDD:291746 20/79 (25%)
PKc_like 155..457 CDD:304357 96/561 (17%)
SPS1 211..>467 CDD:223589 86/514 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4829
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D371612at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11909
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.