DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and csnk1g1

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:XP_009301749.1 Gene:csnk1g1 / 494092 ZFINID:ZDB-GENE-041212-63 Length:466 Species:Danio rerio


Alignment Length:689 Identity:117/689 - (16%)
Similarity:198/689 - (28%) Gaps:328/689 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EADPPT-LLHTPQARSLLLTGASIASDHNNSSVMESPRPVYTLRPSVVNGTILRDVLSKAWRLGR 127
            |||.|. ....||.|          |.|:..|...:...|..:.|:              :|:|:
Zfish     8 EADRPVRSSKVPQGR----------SGHSRPSSSSASSGVLMVGPN--------------FRVGK 48

  Fly   128 PIGKGNFGEIFLASDDTVCPASSETAKYV-VKIEPHSNGPLFVEIHCLINTSRNNDLSDAAEDAA 191
            .||.|||||:.|..       :..|.:|| :|:||..              ||            
Zfish    49 KIGCGNFGELKLGK-------NLYTNEYVAIKLEPVK--------------SR------------ 80

  Fly   192 SLPAPQTHVLSR-----GPPSGIPSFIASGTHYFGDV-RYRFLVLPRFDRDLHSL--IKNSRVQQ 248
               |||.|:..|     |...|:|.     ..|||.. :|..:||......|..|  :.:.....
Zfish    81 ---APQLHLEYRFYKTLGSADGLPQ-----VFYFGPCGKYNAMVLELLGPSLEDLFDLCDRTFSL 137

  Fly   249 KSLLVLAVHIINVLENLHDKGYCHNDIKAQNLMVSKCKYLRRQVVPKGNGYEDHYEEKQQTTDSG 313
            |::|::|:.:|:.:|.:|.|...:.|:|.:|.::.:          :||                
Zfish   138 KTVLMIAIQLISRMEYVHSKNLIYRDVKPENFLIGR----------QGN---------------- 176

  Fly   314 NSSEQETNDDDYFLKSEKFALKKIVDIKQDEDEDDEDFDDGATSNSNNSNSLDVFHTPVNKKRSA 378
                                                                             
Zfish   177 ----------------------------------------------------------------- 176

  Fly   379 RNAIQFSGSNPVRACRREKRNSMYEEMVKSHYLRPTKRISYREEFNEDGYPKETAENSDESPESS 443
                                                                             
Zfish   177 ----------------------------------------------------------------- 176

  Fly   444 DNESDEFIPPSSRRSVIKRGRSAQIATPKKTPVSTRASRQEKVKKEPNGDQKLRSRGSKHLDNNP 508
                                                       |||             |:    
Zfish   177 -------------------------------------------KKE-------------HI---- 181

  Fly   509 TEYKFLPTEEEHVFLIDFGLASKFQDRGVHRPFIMDQRRAHDGTLEFTSRDAHLG-AHSRRSDLE 572
                        :.:||||||.::.|....:.....:.::..||..:.|.:.||| ..|||.|||
Zfish   182 ------------IHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLE 234

  Fly   573 CLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQFYGKQVPKYLGEFLLQIGQL 637
            .||:..:|:..|.|||:.:.....:|:..:..:.......|:|.:.:    |:.:..:|..:.:|
Zfish   235 ALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRNTPIEVLCENF----PEEMATYLRYVRRL 295

  Fly   638 AYQERPNYERYRKIFKREYQRLGYDPCQMRLSSEEILR---TCVSTKDVVDGSKCDIFELNNKAA 699
            .:.|:|:|:..|.:|...:.|.||   ....|.:.:.|   |.|.|..|..|:          :|
Zfish   296 DFFEKPDYDYLRNLFTELFDRKGY---AFDYSYDWVGRQIPTPVGTVHVDSGA----------SA 347

  Fly   700 VNVMRNSTLSTPFQEHSLTNRVSPKNLRS----KSNKKT 734
            :....::....|.|...|.|:.:..:.|.    :.|::|
Zfish   348 ITRESHAHRDRPSQHQPLRNQTAISDRRGAWEVQPNRQT 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 44/182 (24%)
SPS1 123..>284 CDD:223589 44/169 (26%)
SPS1 <491..756 CDD:223589 56/252 (22%)
PKc_like <517..652 CDD:304357 36/135 (27%)
csnk1g1XP_009301749.1 STKc_CK1_gamma 43..330 CDD:271028 91/576 (16%)
SPS1 43..>265 CDD:223589 77/504 (15%)
CK1gamma_C 330..417 CDD:289378 14/67 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.