DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and CkIalpha

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001162737.1 Gene:CkIalpha / 32221 FlyBaseID:FBgn0015024 Length:337 Species:Drosophila melanogaster


Alignment Length:166 Identity:55/166 - (33%)
Similarity:84/166 - (50%) Gaps:12/166 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 HLDNNPTEYKFLPTEEEH---VFLIDFGLASKFQDRGVHRPFIMDQRRAHDGTLEFTSRDAHLG- 563
            |.|..|.  .||.....|   :||||||||.||:|.......:..:.:...||..:.|.:|||| 
  Fly   137 HRDIKPD--NFLMGIGRHCNKLFLIDFGLAKKFRDPHTRHHIVYREDKNLTGTARYASINAHLGI 199

  Fly   564 AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQFYGKQVPKYLG 628
            ..|||.|:|.|||.::|::.|.|||:.:....:|:|..:..|..|:...|:|    .|..|....
  Fly   200 EQSRRDDMESLGYVMMYFNRGVLPWQGMKANTKQQKYEKISEKKMSTPIEVL----CKGSPAEFS 260

  Fly   629 EFLLQIGQLAYQERPNYERYRKIFKREYQRLG--YD 662
            .:|.....|.::|:|:|...|::|:..::.|.  ||
  Fly   261 MYLNYCRSLRFEEQPDYMYLRQLFRILFRTLNHQYD 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357
SPS1 123..>284 CDD:223589
SPS1 <491..756 CDD:223589 55/166 (33%)
PKc_like <517..652 CDD:304357 46/138 (33%)
CkIalphaNP_001162737.1 PKc_like 19..284 CDD:304357 51/152 (34%)
Pkinase_Tyr 23..284 CDD:285015 51/152 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11909
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.