DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsd and CG2577

DIOPT Version :10

Sequence 1:NP_610733.1 Gene:bsd / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_572794.1 Gene:CG2577 / 32188 FlyBaseID:FBgn0030384 Length:344 Species:Drosophila melanogaster


Alignment Length:171 Identity:55/171 - (32%)
Similarity:89/171 - (52%) Gaps:16/171 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 DQKLR------SRGSKHLDNNPTEYKF-LPTEEEHVFLIDFGLASKFQD--RGVHRPFIMDQRRA 548
            :|.||      :||..|.|..|..:.. |.|..:.|:||||||:.|:.|  .|||.|:  .:.|:
  Fly   118 EQMLRRVEYVHNRGFLHRDIKPDNFLMGLGTMSKQVYLIDFGLSKKYLDITTGVHIPY--REERS 180

  Fly   549 HDGTLEFTSRDAHLGAHS-RRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVP 612
            ..||..:.|..||.|..| ||.|:..:||.|:|::.|.|||:|:....:|:|..|..|..::...
  Fly   181 LTGTARYASIGAHAGVESARRDDMVAVGYVLMYFNRGSLPWQDLKASTKQQKYERIHEKKISVSI 245

  Fly   613 EMLRQFYGKQVPKYLGEFLLQIGQLAYQERPNYERYRKIFK 653
            |:|.:.:..:...||.    ....:.:.::|||:...::|:
  Fly   246 EVLCEGFPCEFTMYLN----YCRGMGFYDKPNYDFICRMFR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsdNP_610733.1 Protein Kinases, catalytic domain 112..>286 CDD:473864
Protein Kinases, catalytic domain <517..652 CDD:473864 44/137 (32%)
CG2577NP_572794.1 STKc_CK1 16..281 CDD:270918 54/168 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.