DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and hhp2

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_593184.1 Gene:hhp2 / 2541929 PomBaseID:SPAC23C4.12 Length:400 Species:Schizosaccharomyces pombe


Alignment Length:321 Identity:84/321 - (26%)
Similarity:131/321 - (40%) Gaps:71/321 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   496 LRSRGSKHLDNNPTEYKFLPTEEEHVFLIDFGLASKFQD--RGVHRPFIMDQRRAHDGTLEFTSR 558
            :.|:...|.|..|..: .:......|.:||||||.|::|  ..||.|: .|.:.. .||..:.|.
pombe   122 VHSKSFLHRDIKPDNF-LMKKHSNVVTMIDFGLAKKYRDFKTHVHIPY-RDNKNL-TGTARYASI 183

  Fly   559 DAHLG-AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQFYGKQ 622
            :.|:| ..|||.|||.|||.|||:..|.|||:.:....:::|..|.::..:....|:|    .|.
pombe   184 NTHIGIEQSRRDDLESLGYVLLYFCRGSLPWQGLQADTKEQKYQRIRDTKIGTPLEVL----CKG 244

  Fly   623 VPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLGYDPCQMRLSSEEILRTCVSTKDVVDGS 687
            :|:....::....||::.|:|||...||:|:....|.||                 ....|.|..
pombe   245 LPEEFITYMCYTRQLSFTEKPNYAYLRKLFRDLLIRKGY-----------------QYDYVFDWM 292

  Fly   688 KCDIFELNNKAAVNVMRNSTLSTPFQEHSLTNRVSPKN----------LRSKSNKKTTKKKFSWA 742
               |.:...:||.....::| :.|.....:.::..|.|          |.::.|.| |.:.||..
pombe   293 ---ILKYQKRAAAAAAASAT-APPQVTSPMVSQTQPVNPITPNYSSIPLPAERNPK-TPQSFSTN 352

  Fly   743 EVLSQDPDQIARERAVKEFEREETICPLESRLP---RRYEG-----KPTYA-----ILDME 790
            .|....|..:                ||..|.|   :.||.     :|.|:     :||.|
pombe   353 IVQCASPSPL----------------PLSFRSPVPNKDYEYIPSSLQPQYSAQLRRVLDEE 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357
SPS1 123..>284 CDD:223589
SPS1 <491..756 CDD:223589 73/272 (27%)
PKc_like <517..652 CDD:304357 48/137 (35%)
hhp2NP_593184.1 SPS1 11..353 CDD:223589 71/259 (27%)
PKc_like 11..283 CDD:304357 54/167 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.