DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsd and K08H2.5

DIOPT Version :10

Sequence 1:NP_610733.1 Gene:bsd / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001361832.1 Gene:K08H2.5 / 187176 WormBaseID:WBGene00010692 Length:304 Species:Caenorhabditis elegans


Alignment Length:355 Identity:66/355 - (18%)
Similarity:125/355 - (35%) Gaps:109/355 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 DVLSKAWRLGRPIGKGNFGEIFLASDDTVCPASSETAKYVVKIEPHSN-GPLFVEIHCL------ 174
            ||| :.:::...:|.|.:|..|...|     |.|..:...:|.   || ..:|.| :|.      
 Worm     8 DVL-RNYKIVEVLGSGEYGTAFACVD-----ADSRHSTLALKA---SNLETIFCE-NCFKLERTV 62

  Fly   175 ---INTSRNNDLSDAAEDAASLPAPQTHVLSRGPPSGIPSFIASGTHYFGDVRYRFLVLPRFDRD 236
               |:|...|:.|..                   |:.:.:|:...|       ...||:.:....
 Worm    63 LQRISTLGTNEKSRF-------------------PTLVDNFVVDST-------LGCLVMTKEGDS 101

  Fly   237 LHSLIKNS---RVQQKSLLVLAVHIINVLENLHDKGYCHNDIKAQNLMVSK-------CKYLRRQ 291
            |..:.|.:   :....::|.:.:.:...|:.:|..||.|.||...|::.:|       ||.:...
 Worm   102 LGDVCKRNDPKKFSPTNVLKIMLSVGKSLQTIHSLGYIHRDIHWNNVLFAKTITPASPCKLIDYG 166

  Fly   292 VVPKGNGYEDHYEEKQQTTDSGNSSEQETNDDDYFLKSEKFALKKIVDIKQDEDEDDEDFDDGAT 356
            |..|......:|.:        |..:::.|..:....|....:..:.::|       :||     
 Worm   167 VGKKFRNRRGNYVK--------NRPQRDVNFKECGHVSWNVMMGGVPNLK-------DDF----- 211

  Fly   357 SNSNNSNSLDVFHTPVNKKRSARNAIQFSGSNPVRACRREKRNSMYEEMVKSHYLR--------- 412
                  :|| :|   :..|.|..::::....:.||      ...|..|:..|.:||         
 Worm   212 ------SSL-MF---LGLKISGISSLEIGSVSEVR------HQKMIFELDPSRFLRSVPWLLKVA 260

  Fly   413 ------PTKRISYREEFN--EDGYPKETAE 434
                  ..::.:|...||  :.|:|.:..|
 Worm   261 CVIVDSDAEKFNYAGVFNAIKQGFPFDEEE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsdNP_610733.1 Protein Kinases, catalytic domain 112..>286 CDD:473864 37/188 (20%)
Protein Kinases, catalytic domain <517..652 CDD:473864
K08H2.5NP_001361832.1 Protein Kinases, catalytic domain 12..>185 CDD:473864 40/215 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.