DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and K06H7.8

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_498768.1 Gene:K06H7.8 / 187079 WormBaseID:WBGene00019459 Length:346 Species:Caenorhabditis elegans


Alignment Length:391 Identity:76/391 - (19%)
Similarity:140/391 - (35%) Gaps:124/391 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 VLSKAWRLGRPIGKGNFGEIFLASDDTVCPASSETAKYVVKIEPHSNGPLFVEIHCLINTSRNND 182
            |:.|.:::.:.:|:|..|.:|...|     .|.:...|.:|:|..|                   
 Worm    15 VVGKRYKVVQKLGEGGCGSVFKVED-----TSEKGQHYALKVEFKS------------------- 55

  Fly   183 LSDAAEDAASLPAPQTHVLSR-GPPSGIPSFIASGTHYFGDVRYRFLVLPRFDRDLHSLIK---- 242
                 :||.::...:..:||: .....:...:|||.    ..||.::|:......|.||:|    
 Worm    56 -----QDAGNILKMEVQILSQLISKKHVAKCVASGK----KERYSYMVMTLLGESLDSLLKKHGP 111

  Fly   243 --NSRVQQKSLLVLAVHIINVLENLHDKGYCHNDIKAQNLMVSKCKYLRRQVVPKGNGYEDHYEE 305
              |...|.:    :.:.|:..::.:||.||.|.|:|..|:.:. |         ||:..|.::  
 Worm   112 FLNVSTQVR----IGICILFGIKQVHDIGYLHRDLKPANVAMG-C---------KGSADERYF-- 160

  Fly   306 KQQTTDSGNSSEQETNDDD-----------YFLKSEKFALKKIVDIKQDEDEDD----------- 348
              ...|.|.:.:...::||           ||..:.::....:.|..:....||           
 Worm   161 --LVLDFGLARQYIADEDDGLKMRRPREKTYFRGTARYCSVAMHDRYEQGRVDDLWALVYILAEM 223

  Fly   349 ------EDFDDGATSNSNNSNSLDVFHTPVNKKRSARNAIQFSGSNPVRACRREK--RNSM---- 401
                  .|.||.....              ..||...:.:.|:.| ||:.....|  |:::    
 Worm   224 RCRLAWHDVDDKVEIG--------------EMKRKIHDEVLFAKS-PVQMLSFVKTVRSTLFYHR 273

  Fly   402 --YEEMVK---------------SHYLRPTKRISYREEFNEDGYPKETAENSDESPESSDNESDE 449
              ||::.|               .::..|.|:.:...:.|:.|..|:..:.|.|.||:|....|:
 Worm   274 PDYEKLFKLLEDVMKCANYKWSDPYHWEPEKKKNPASQGNKFGLGKKGTKESGELPEASFFTVDD 338

  Fly   450 F 450
            |
 Worm   339 F 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 37/174 (21%)
SPS1 123..>284 CDD:223589 35/167 (21%)
SPS1 <491..756 CDD:223589
PKc_like <517..652 CDD:304357
K06H7.8NP_498768.1 STKc_TTBK 19..284 CDD:270919 62/330 (19%)
S_TKc 20..263 CDD:214567 57/308 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.