DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and F41G3.5

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_495378.2 Gene:F41G3.5 / 185631 WormBaseID:WBGene00018301 Length:331 Species:Caenorhabditis elegans


Alignment Length:221 Identity:54/221 - (24%)
Similarity:83/221 - (37%) Gaps:49/221 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 NGDQKLRSRGSKHLDNNPTEYKFLPTEEEHVFLIDFGLASKFQDRG----------VHRPFIMDQ 545
            |..|:|.|.|..|.|..|..:.........:.::|||:..|:.:.|          ||       
 Worm   135 NAIQQLHSIGFIHRDIKPANFCINLDNPHQLVMVDFGMCRKYLNDGGTQLRHPRWSVH------- 192

  Fly   546 RRAHDGTLEFTSRDAHLGAHS-RRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVH--RAKELF 607
              ...||:.:.....|.|..| |:.|||.:.|.|:....|.|||     ...:|.:|  .:|::.
 Worm   193 --GFRGTVRYAPLATHYGRDSCRKEDLETIFYVLVELLVGTLPW-----MTMEEHIHVEHSKQVA 250

  Fly   608 MTDVPEMLRQFYGKQVPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLGYDPCQ------- 665
            .|   ..||:|. ...||.|...||.|..|.:.:.|:|...|.:..     ...:.||       
 Worm   251 RT---TGLREFL-SGCPKQLVHILLYIDNLRFYDAPDYALIRGLLS-----FALENCQHNGSFEW 306

  Fly   666 -----MRLSSEEILRTCVSTKDVVDG 686
                 |....:|.:|: ....::.||
 Worm   307 EEEMKMERKKDEDMRS-KDESEIEDG 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357
SPS1 123..>284 CDD:223589
SPS1 <491..756 CDD:223589 54/221 (24%)
PKc_like <517..652 CDD:304357 39/147 (27%)
F41G3.5NP_495378.2 PKc_like 28..292 CDD:389743 47/174 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4829
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.