DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsd and F39F10.3

DIOPT Version :10

Sequence 1:NP_610733.1 Gene:bsd / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_510730.1 Gene:F39F10.3 / 185498 WormBaseID:WBGene00018203 Length:298 Species:Caenorhabditis elegans


Alignment Length:167 Identity:41/167 - (24%)
Similarity:72/167 - (43%) Gaps:40/167 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 WRLGRPIGKGNFGEIFLASDDTVCPASSETAKYVVKIEPHSNGPLFVEIHCLINTSRNNDLSDA- 186
            :.|.:.:|||.:||:.|..||.  ...:..||.::|                    .:|.:.|. 
 Worm    10 YTLEKLLGKGMYGEVHLCKDDR--NNEARVAKLILK--------------------EHNGIRDKS 52

  Fly   187 -AEDAASLPAPQTHVLSRGPPSGIPSFIASG-THYFGDVRYRFLVLPRFDRDLHSLI---KNSRV 246
             |.:..:|.|.       ...:|:|...|:| |.|     :.::|:.....||..:|   :|.:.
 Worm    53 WAHETLALNAV-------AGVNGVPRMFATGSTDY-----HNWIVMDLLSDDLEVIICRNENKKF 105

  Fly   247 QQKSLLVLAVHIINVLENLHDKGYCHNDIKAQNLMVS 283
            .:.:...:...::.:|:::|.||..|.|||..|||||
 Worm   106 AKATGYQILWQVVKILKDIHSKGIVHGDIKPNNLMVS 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsdNP_610733.1 Protein Kinases, catalytic domain 112..>286 CDD:473864 41/167 (25%)
Protein Kinases, catalytic domain <517..652 CDD:473864
F39F10.3NP_510730.1 Protein Kinases, catalytic domain 9..274 CDD:473864 41/167 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.