DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and F39F10.3

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_510730.1 Gene:F39F10.3 / 185498 WormBaseID:WBGene00018203 Length:298 Species:Caenorhabditis elegans


Alignment Length:167 Identity:41/167 - (24%)
Similarity:72/167 - (43%) Gaps:40/167 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 WRLGRPIGKGNFGEIFLASDDTVCPASSETAKYVVKIEPHSNGPLFVEIHCLINTSRNNDLSDA- 186
            :.|.:.:|||.:||:.|..||.  ...:..||.::|                    .:|.:.|. 
 Worm    10 YTLEKLLGKGMYGEVHLCKDDR--NNEARVAKLILK--------------------EHNGIRDKS 52

  Fly   187 -AEDAASLPAPQTHVLSRGPPSGIPSFIASG-THYFGDVRYRFLVLPRFDRDLHSLI---KNSRV 246
             |.:..:|.|.       ...:|:|...|:| |.|     :.::|:.....||..:|   :|.:.
 Worm    53 WAHETLALNAV-------AGVNGVPRMFATGSTDY-----HNWIVMDLLSDDLEVIICRNENKKF 105

  Fly   247 QQKSLLVLAVHIINVLENLHDKGYCHNDIKAQNLMVS 283
            .:.:...:...::.:|:::|.||..|.|||..|||||
 Worm   106 AKATGYQILWQVVKILKDIHSKGIVHGDIKPNNLMVS 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 41/167 (25%)
SPS1 123..>284 CDD:223589 41/167 (25%)
SPS1 <491..756 CDD:223589
PKc_like <517..652 CDD:304357
F39F10.3NP_510730.1 PKc_like 9..274 CDD:389743 41/167 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.