Sequence 1: | NP_001260913.1 | Gene: | CG8878 / 36302 | FlyBaseID: | FBgn0027504 | Length: | 1004 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491697.1 | Gene: | F33D11.7 / 185229 | WormBaseID: | WBGene00018004 | Length: | 347 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 44/199 - (22%) |
---|---|---|---|
Similarity: | 84/199 - (42%) | Gaps: | 44/199 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 477 STRASRQEKVKKEPNGD-----------------QKLRSRGSKHLDNNPTEYKF------LPTEE 518
Fly 519 EHVFLIDFGLASKFQDR-GVHRPFIMDQRRAHD----GTLEFTSRDAHLGAH-SRRSDLECLGYN 577
Fly 578 LLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQFYGKQVPKYLGEFLLQIGQLAYQER 642
Fly 643 PNYE 646 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8878 | NP_001260913.1 | PKc_like | 112..>286 | CDD:304357 | |
SPS1 | 123..>284 | CDD:223589 | |||
SPS1 | <491..756 | CDD:223589 | 38/185 (21%) | ||
PKc_like | <517..652 | CDD:304357 | 33/136 (24%) | ||
F33D11.7 | NP_491697.1 | STKc_TTBK | 41..315 | CDD:270919 | 44/199 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1164 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |