Sequence 1: | NP_001260913.1 | Gene: | CG8878 / 36302 | FlyBaseID: | FBgn0027504 | Length: | 1004 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510698.2 | Gene: | F22H10.1 / 184871 | WormBaseID: | WBGene00017725 | Length: | 207 | Species: | Caenorhabditis elegans |
Alignment Length: | 198 | Identity: | 38/198 - (19%) |
---|---|---|---|
Similarity: | 75/198 - (37%) | Gaps: | 62/198 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 245 RVQQKSLLVLAVHIINVLENLHDKGYCHNDIKAQNLMVS--------------KCKYLRRQVVPK 295
Fly 296 GNGYEDHYEEKQQTTDSGNSSEQETN---------DDDY------FLKSEKFA----LKKIVDIK 341
Fly 342 QDEDEDDEDFDDGATSNSNNSNSLDVFHTPVNKKRSARNAIQFSGSNPVRACRREKRNSMYEEMV 406
Fly 407 KSH 409 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8878 | NP_001260913.1 | PKc_like | 112..>286 | CDD:304357 | 15/54 (28%) |
SPS1 | 123..>284 | CDD:223589 | 14/52 (27%) | ||
SPS1 | <491..756 | CDD:223589 | |||
PKc_like | <517..652 | CDD:304357 | |||
F22H10.1 | NP_510698.2 | PKc | <3..127 | CDD:270622 | 26/115 (23%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1164 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |