DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsd and F22F1.2

DIOPT Version :10

Sequence 1:NP_610733.1 Gene:bsd / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_509374.1 Gene:F22F1.2 / 184850 WormBaseID:WBGene00017714 Length:299 Species:Caenorhabditis elegans


Alignment Length:190 Identity:45/190 - (23%)
Similarity:80/190 - (42%) Gaps:49/190 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 LGRPIGKGNFGEIFLASDDTVCPASSETAKY-VVKIEPHSNGPLFVEIHCLINTSRNNDLSDAAE 188
            |.:.:|:|::|:::...|:       ...|: |:|:           ||..||..|  |.:...|
 Worm    13 LEKKLGEGSYGDVYFCRDE-------RNNKWSVIKL-----------IHKEINGVR--DETWRRE 57

  Fly   189 DAASLPAPQTHVLSRGPPSGIPSFIASGTHYFG--DVRYRFLVLPRFDRDLHSLIKNSRVQ--QK 249
            ..|.....:...:||             .:.:|  |:....::.|..| ||.::.:.:.::  .|
 Worm    58 TFALTALAEVRGISR-------------MYDYGATDIHNYIVMEPLLD-DLTNIARRNGIKGFSK 108

  Fly   250 SLLVLAVHI----INVLENLHDKGYCHNDIKAQNLMVS-KCKYLRRQVVPKG--NGYEDH 302
            |   ...||    :.:|:::|..|..|.||||.|||:| ..|.....:|..|  ..::||
 Worm   109 S---TGFHILWQLVKILQDVHSFGIAHGDIKADNLMISGSNKTFMLSLVDFGLSRSFKDH 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsdNP_610733.1 Protein Kinases, catalytic domain 112..>286 CDD:473864 40/170 (24%)
Protein Kinases, catalytic domain <517..652 CDD:473864
F22F1.2NP_509374.1 Protein Kinases, catalytic domain 15..272 CDD:473864 44/188 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.