Sequence 1: | NP_001260913.1 | Gene: | CG8878 / 36302 | FlyBaseID: | FBgn0027504 | Length: | 1004 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_499308.1 | Gene: | D2045.5 / 183952 | WormBaseID: | WBGene00008423 | Length: | 351 | Species: | Caenorhabditis elegans |
Alignment Length: | 238 | Identity: | 52/238 - (21%) |
---|---|---|---|
Similarity: | 85/238 - (35%) | Gaps: | 71/238 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 VLSKAWRLGRPIGKGNFGEIFLASDDTVCPASSETAKYVVKIEPHSNGPLFVEIHCLINTSRNND 182
Fly 183 LSDAAEDAASLPAPQTHVLSRGPPSGIPSFIASGTHYFGDVR-YRFLVLPRFDRDL--HSLIKNS 244
Fly 245 -RVQQKSLLVLAVHIINVLENLHDKGYCHNDIKAQNLMV------SKCKYL------RRQVVPKG 296
Fly 297 NGYEDHYEEKQQTTDSG----------------NSSEQETNDD 323 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8878 | NP_001260913.1 | PKc_like | 112..>286 | CDD:304357 | 39/177 (22%) |
SPS1 | 123..>284 | CDD:223589 | 37/170 (22%) | ||
SPS1 | <491..756 | CDD:223589 | |||
PKc_like | <517..652 | CDD:304357 | |||
D2045.5 | NP_499308.1 | STKc_TTBK | 16..277 | CDD:270919 | 51/234 (22%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1164 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |