DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsd and C17C3.11

DIOPT Version :10

Sequence 1:NP_610733.1 Gene:bsd / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_001370446.1 Gene:C17C3.11 / 182720 WormBaseID:WBGene00015893 Length:161 Species:Caenorhabditis elegans


Alignment Length:126 Identity:23/126 - (18%)
Similarity:46/126 - (36%) Gaps:33/126 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 DVLSKAWRLGRPIGKGNFGEIFLASDDTVCPASSETAKYVVKIEPHSNGPLFVEIHCLINTSRNN 181
            |...:.:::.:.:..|.||.::...||    |..|   :|:|.:.::.....:.|...:.|.   
 Worm    12 DYRVRRYKVFKKLEDGEFGAVYAVRDD----AGEE---HVLKAQLNTKEIYSLRIELCVMTK--- 66

  Fly   182 DLSDAAEDAASLPAPQTHVLSRGPPSGIPSFIASGTHYFGDVRYRFLVLPRFDRDLHSLIK 242
                               :|...||.:|:.|..|.|    ..:.::|:....:.|...||
 Worm    67 -------------------VSEKSPSHMPTLIDKGRH----DNFNYIVMKLLGKSLQDAIK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bsdNP_610733.1 Protein Kinases, catalytic domain 112..>286 CDD:473864 23/126 (18%)
Protein Kinases, catalytic domain <517..652 CDD:473864
C17C3.11NP_001370446.1 Protein Kinases, catalytic domain 17..>112 CDD:473864 22/121 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.