DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and C27D8.1

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_502428.1 Gene:C27D8.1 / 178226 WormBaseID:WBGene00007777 Length:327 Species:Caenorhabditis elegans


Alignment Length:349 Identity:71/349 - (20%)
Similarity:121/349 - (34%) Gaps:110/349 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 DEDEDDEDFDDGATSNSNNSNSLDVFHTPV------------------NKKRSARNAIQFSGSNP 389
            ||:|:|.:|..|...:|..:|     :|.|                  :||:||...        
 Worm     3 DEEEEDVNFKPGTEISSTKAN-----YTVVRLLGEGGFGAVYLVQDNKSKKQSAMKV-------- 54

  Fly   390 VRACRREKRNSMYEEMVKSHYLRPTKRISYREEFNEDGYPKETAENSDESPESSDNESDEFIPPS 454
            .|...:.|.:.:..|      :...|.:...:.|.:                             
 Worm    55 ERKIEKRKHSKLKME------IAILKLVGSGKHFTQ----------------------------- 84

  Fly   455 SRRSVIKRGRSAQ-------IATPKKTPVSTRASRQEKVKKEPNG----------DQKLRSRGSK 502
                ::.||:..:       :....|:....:|.|.:||.....|          .::|...|..
 Worm    85 ----IVDRGKKDKEGFFFLVMELVGKSLADLKADRPDKVFSFATGLGVSCQCLEAVEELHKTGFI 145

  Fly   503 HLDNNPTEYKFLPTEEEH-VFLIDFGLASKFQDRGVHRPFIMDQRRAHDGTLEF--TSRDAHLGA 564
            |.|..|..|.....|:.| ::::|||:|.|:.:       ..::.:....|:.|  |.|.|.:..
 Worm   146 HRDLKPQNYACGLDEKRHNIYILDFGIARKYLN-------TKNELKTPRETVGFKGTVRFAPIAC 203

  Fly   565 HSR-----RSDLECLGYNL--LYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQFYGKQ 622
            |..     :.|.|...|.|  |....| |||:.::.:.:   |.:.||....|....|  |.|.:
 Worm   204 HRNTEMGPKDDCESWFYLLLDLIVPSG-LPWRKLSDKHE---VLKEKEECRKDKRSSL--FAGLR 262

  Fly   623 VPKYLGEFLLQIGQLAYQERPNYE 646
            ...||.:.|..|...|||:|.:|:
 Worm   263 QTDYLSKVLDYIDGRAYQDRVDYQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357
SPS1 123..>284 CDD:223589
SPS1 <491..756 CDD:223589 45/176 (26%)
PKc_like <517..652 CDD:304357 38/140 (27%)
C27D8.1NP_502428.1 PKc_like 23..290 CDD:389743 64/329 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.