DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and R13H9.5

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_500715.1 Gene:R13H9.5 / 177276 WormBaseID:WBGene00020071 Length:311 Species:Caenorhabditis elegans


Alignment Length:358 Identity:62/358 - (17%)
Similarity:122/358 - (34%) Gaps:133/358 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 PRPVYTLRPSVVNGTILRDVLSKAWRLGRPIGKGNFGEIFLASDDTVCPASSETAKYVVKIEPHS 163
            |.|:..|.|    |:::     :.|.:.:.:|:|..|.::|.:|        .|.||.:|:|..|
 Worm     5 PPPLVELPP----GSMV-----ERWSITKKLGEGGCGAVYLCTD--------ATGKYALKVEGIS 52

  Fly   164 NGPLFVEIHCLINTSRNNDLSDAAEDAASLPAPQTHVLSRGPPSGIPSFIASGTHYFGDVR---- 224
            .....:::..|:                                 :......|:.:|..:.    
 Worm    53 EAMQVLKMEVLV---------------------------------LGELTKRGSRHFCKIEDKGR 84

  Fly   225 ---YRFLVLPRFDRDLHSLIKNSRVQQKSL---LVLAVHIINVLENLHDKGYCHNDIKAQNLMVS 283
               :.::|:....:.|..|.|.:..|..||   |.:.:..:..||:||:.||.|.|:|..|..:.
 Worm    85 YGSFNYVVMTLVGKSLQDLRKGTAQQCLSLACSLSVGIQSLEALEDLHNIGYLHRDVKPGNYTIG 149

  Fly   284 KCKYLRRQVVPKGNGYEDHYEEKQQTTDSGNSSEQETNDDDYFLKSEKFALKKIVDIKQDEDEDD 348
            :.                                 |.|:           |:|:..:        
 Worm   150 RA---------------------------------ELNE-----------LRKVYIL-------- 162

  Fly   349 EDFDDGATSNSNNSNSLDVFHTPVNKKRSA---RNAIQFSGSNPVRACRREKRNSMYEEMVKSHY 410
             ||........||.        .:.|.|:|   |..::::   |: ||.:.:.....:::....|
 Worm   163 -DFGMARKFTDNNG--------VIRKPRAAAGFRGTVRYA---PI-ACHKNQELGRKDDVEVWLY 214

  Fly   411 LR---PTKRISYRE--EFNEDGYPKETAENSDE 438
            ::   ...|:.::|  :.|..|..|:|..|:.|
 Worm   215 MQVELTVGRVPWKEITDMNAVGQAKQTIRNTPE 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 34/183 (19%)
SPS1 123..>284 CDD:223589 33/170 (19%)
SPS1 <491..756 CDD:223589
PKc_like <517..652 CDD:304357
R13H9.5NP_500715.1 STKc_TTBK 19..285 CDD:270919 57/335 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.