DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and C09B9.4

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_500708.1 Gene:C09B9.4 / 177271 WormBaseID:WBGene00015629 Length:359 Species:Caenorhabditis elegans


Alignment Length:209 Identity:47/209 - (22%)
Similarity:78/209 - (37%) Gaps:66/209 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 IASDHNNSSVMESPRPVYTLRPSVVNGTILRDVLSKAWRLGRPIGK-------GNFGEIFLASDD 143
            :||.|.||:                 ..:|..:|.|..|||..:.|       |.|..:||...|
 Worm     2 VASPHRNST-----------------NDLLMPLLGKRIRLGDHVYKMCDSIATGPFSSVFLVEKD 49

  Fly   144 TVCPASSETAKYVVKIEPHSNGPLFVEIHCLINTSRNNDLSDAAEDAASLPAPQTHVLSR--GPP 206
            .:        .|.:|:|..|.        ||....:.:                 |.:.|  |..
 Worm    50 GI--------PYAMKVESQSK--------CLRPVLKLD-----------------HAVLRALGHQ 81

  Fly   207 SGIPSFIASGTHYFGDVRYRFLVLPRFDRDLHSLIK---NSRVQQKSLLVLAVHIINVLENLHDK 268
            ||.||..::|.    ...::::|:.....||..|::   ..|....::..:|:..::.|..||:.
 Worm    82 SGFPSLTSAGR----TENFKYVVMQLVGPDLSMLLEFAPQQRFTSSTVYKIALQTLDRLRVLHEA 142

  Fly   269 GYCHNDIKAQNLMV 282
            |:.:.|:||||..|
 Worm   143 GWLNRDVKAQNFAV 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357 42/183 (23%)
SPS1 123..>284 CDD:223589 39/172 (23%)
SPS1 <491..756 CDD:223589
PKc_like <517..652 CDD:304357
C09B9.4NP_500708.1 PKc_like 29..289 CDD:389743 36/165 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.