DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and spe-6

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_499482.1 Gene:spe-6 / 176582 WormBaseID:WBGene00004960 Length:379 Species:Caenorhabditis elegans


Alignment Length:233 Identity:60/233 - (25%)
Similarity:100/233 - (42%) Gaps:37/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   518 EEHVFLIDFGLASKFQDRGVHRPFIMDQRRAHD--GTLEFTSRDAHLGAHS---RRSDLEC---L 574
            |..|:::|||.|.||.|:   ...|:..|.|..  ||.::.:..||  :|.   .|.|||.   :
 Worm   161 ESTVYILDFGFARKFVDK---EGKIIPPRTAAALMGTFQYCAVSAH--SHKDQCARDDLESWFYM 220

  Fly   575 GYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQFYGKQVPKYLGEFLLQIGQLAY 639
            |..||   :|.|||.::...:..:::..||....:   |.||..:.:.|||...|.|..:.|.:|
 Worm   221 GIELL---KGPLPWANIDGHKNHKQIGEAKVAIRS---EPLRSEFFEGVPKQFNEILTILDQTSY 279

  Fly   640 QERPNYERYRKIFKR---EYQRLGYDPCQMRLSSEEILRTCVSTKDVVDGSKCDIFELNNKAAVN 701
            .:||||::...:..:   |:|....:|...:.:..      :..|.:..|...:..:.:.|....
 Worm   280 FDRPNYKKLGDLLSQAATEHQVTLKEPLDWQNNER------MQQKAIFVGELGESHQASAKLDAK 338

  Fly   702 VMRNSTLSTPFQEHSLTNRVSPKNLRSKS---NKKTTK 736
            ...|.::...|.:      :.||...|||   .|..||
 Worm   339 DNANESMDIEFDD------MPPKEGISKSLSAEKSCTK 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357
SPS1 123..>284 CDD:223589
SPS1 <491..756 CDD:223589 60/233 (26%)
PKc_like <517..652 CDD:304357 44/141 (31%)
spe-6NP_499482.1 STKc_TTBK 25..293 CDD:270919 44/142 (31%)
S_TKc 26..271 CDD:214567 37/120 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.