DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and C56C10.6

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_495333.1 Gene:C56C10.6 / 174087 WormBaseID:WBGene00016963 Length:422 Species:Caenorhabditis elegans


Alignment Length:343 Identity:77/343 - (22%)
Similarity:128/343 - (37%) Gaps:81/343 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 QKLRSRGSKHLDNNPTE----YKFLPTEEEHVFLIDFGLASKFQDRGVHRPFIMDQRRAHD---- 550
            :::...|..|.|..|..    ||....|.....::|||||.:|......:|..:..||..:    
 Worm   133 KQIHDIGFIHRDLKPANMALGYKTNNDECRFFHVLDFGLARQFVVSQSDQPSKLMMRRPRERSLF 197

  Fly   551 -GTLEFTSRDAHLGAHSRR-SDLECLGYNLLYWSEGYLPWKDVAQQQ---QQEKVHRAKELFMTD 610
             ||..:.|...|..|...| .||..:.| ||....|.|||...:.::   :.:::|..:.:....
 Worm   198 RGTTRYCSIRMHDRAEQGRVDDLWSMVY-LLAELRGPLPWSSQSDKRVVGEMKRLHSDEVVLQNS 261

  Fly   611 VPEMLRQFYGKQVPKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLGYDPCQMRLSSEEILR 675
            ..|.|      ::.|||       ..|.|..||:   |.|||             |.|.|     
 Worm   262 PMEFL------EIAKYL-------RSLTYFHRPD---YHKIF-------------MLLIS----- 292

  Fly   676 TCVSTKDVVDGSKCDIFELNNKAAVNVMRNSTLSTPFQEHSLTNRVSPKNLRSKSNKKTTKKKFS 740
                   |:...|   |..|:.....:..::|.|......|:|.  ||..|..::.||.:::|..
 Worm   293 -------VMSKGK---FAWNDPFDWEMPISTTPSKSTPSKSVTK--SPAQLSKETVKKASREKTL 345

  Fly   741 WAEVLSQDPDQIARERAVKEFEREETICPLESRLPRRYEGKPTYAILDMEQRRREKGLVVQEHIE 805
            ..|..|::..:.||:.::::..:|:                     |..:...:||..:..|.|.
 Worm   346 SKEKTSKEDIKTARKTSIEKDVKEK---------------------LSKDMASKEKISLSAEKIN 389

  Fly   806 EEEEDADEDDEEENQEAM 823
            ...|..:||:::|....|
 Worm   390 MSAEKIEEDNKKEEYMRM 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357
SPS1 123..>284 CDD:223589
SPS1 <491..756 CDD:223589 66/274 (24%)
PKc_like <517..652 CDD:304357 37/143 (26%)
C56C10.6NP_495333.1 PKc_like 24..290 CDD:389743 46/186 (25%)
CAF-1_p150 322..>407 CDD:371622 22/107 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.