DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8878 and csnk-1

DIOPT Version :9

Sequence 1:NP_001260913.1 Gene:CG8878 / 36302 FlyBaseID:FBgn0027504 Length:1004 Species:Drosophila melanogaster
Sequence 2:NP_492694.1 Gene:csnk-1 / 172891 WormBaseID:WBGene00013709 Length:407 Species:Caenorhabditis elegans


Alignment Length:223 Identity:61/223 - (27%)
Similarity:102/223 - (45%) Gaps:23/223 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 SKHL---DNNPTEYKF--LPTEEEHVF-LIDFGLASKFQDRGVHRPFIMDQRRAHDGTLEFTSRD 559
            :|||   |..|..:..  ..|.::||. :||||||.::.|....:.....:.::..||..:.|.:
 Worm   140 TKHLIYRDVKPENFLIGRYSTRKQHVLHIIDFGLAKEYIDCDTGKHIAYREHKSLTGTARYMSIN 204

  Fly   560 AHLG-AHSRRSDLECLGYNLLYWSEGYLPWKDVAQQQQQEKVHRAKELFMTDVPEMLRQFYGKQV 623
            .||| ..|||.|||.||:..:|:..|.|||:.:.....:|:..:..:.......|:|.:.:    
 Worm   205 THLGKEQSRRDDLEALGHMFMYFLRGSLPWQGLKADTLKERYQKIGDTKRQTAVEVLCEGF---- 265

  Fly   624 PKYLGEFLLQIGQLAYQERPNYERYRKIFKREYQRLG--YD------PCQMRLSSEEILRTCVST 680
            |....::|....:|.:.|.|:|:....:||....|||  ||      |   :|::.......:.|
 Worm   266 PDEFAQYLRYARRLDFFETPDYDFCYNLFKSVLDRLGATYDYEFDWTP---KLNNVSTPSGSLHT 327

  Fly   681 KDVVDGSKCDIFELN-NKAAVNVMRNST 707
            .:..|..:.|..||. ::||.:....||
 Worm   328 SESKDVKRTDRGELKVSQAAAHAQFGST 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8878NP_001260913.1 PKc_like 112..>286 CDD:304357
SPS1 123..>284 CDD:223589
SPS1 <491..756 CDD:223589 61/223 (27%)
PKc_like <517..652 CDD:304357 37/136 (27%)
csnk-1NP_492694.1 STKc_CK1_gamma 27..314 CDD:271028 51/180 (28%)
SPS1 27..>249 CDD:223589 35/108 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.